KEGG   Vibrio coralliilyticus RE98: IX92_18895Help
Entry
IX92_18895        CDS       T03444                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vcy  Vibrio coralliilyticus RE98
Pathway
vcy00500  Starch and sucrose metabolism
vcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    IX92_18895
Enzymes [BR:vcy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     IX92_18895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AIW21101
LinkDB All DBs
Position
2:632998..634350
Genome map
AA seq 450 aa AA seqDB search
MTAFKTANVILHAFDWPYALVAQRADEIVAAGYKSVLVSPPMKSLKHAQGTKWWQRYQPQ
DYRVIDNQLGNTQDFTSMVDALNQRSIYVYADVVFNHMANESHQRLDLQYPAKEVLESYQ
SDSDYYEEIKLFGDLSKPLFIEDDFVEAFGIEDWQDKWQVQNGRITGGPTDPGLPTLRVH
ERVVEQQQHYLKALKALGVKGFRIDAAKHMTLEHLQQVWSKDICEGIHIFGEIITDGGAT
KPEYDIFLEPFLAETRLGAYDFPLFQTMFDAFEAKGSLKSLVNPYCFGQALSENRAITFA
ITHDIPNNDVFANLVMPGKTEWLAYSYILGRDGGVPLVYTDLDTSGLKGTDGKPRWVDAW
NDERMIARIRFYNLMHGKTMQVIEASEDLLVFARGKEGIVVINKSKRPQKVQIAASGEWL
DLLSGEKYQAQKGTLNVTVSGEESLMLVAE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttttaagacagccaacgtcattcttcatgccttcgactggccgtatgcatta
gttgctcaacgcgctgatgagatcgttgcggcgggttataaatctgtgctggtttctcct
ccgatgaagtctttaaaacacgcacagggtacaaagtggtggcagcgttatcagccacaa
gattatcgcgtaattgataaccaactgggcaacacacaagactttacaagtatggtcgac
gcgctaaatcagcgctctatctatgtgtatgcggatgtagtgtttaaccacatggcgaac
gaatcccatcagcgattggatctgcaatatccggctaaagaagttctggaatcctaccaa
agcgattctgattactacgaagagataaaactattcggcgatctcagtaaacctctattt
attgaggatgattttgttgaagcgttcggtattgaagattggcaagacaagtggcaggta
caaaatggtcgtattaccggtggcccaacggatccggggttgccaactctgcgagtgcat
gaacgcgtcgttgaacaacaacagcattacctaaaggcgctgaaagcactgggtgtgaaa
ggttttcgaatcgatgcggccaaacacatgacactagagcatttgcagcaggtatggagc
aaagatatctgtgaaggtattcatatctttggtgaaatcatcacagatggtggagctacc
aagcccgagtatgacatttttctcgaaccgtttttggctgaaacacgtttgggcgcgtat
gactttccattgttccagaccatgtttgatgcatttgaagcgaagggaagtcttaaaagc
ttggtcaacccttattgtttcggccaagcactttctgagaatcgagccattactttcgcg
attactcatgacatacctaacaacgatgtgtttgctaatttagtgatgccaggcaaaaca
gaatggctggcgtacagctatatcttgggcagagatggtggtgtcccattggtttatacc
gatcttgataccagcggtttgaaaggaacggatgggaaaccgcgctgggtagacgcttgg
aatgatgagcgaatgattgcccggattcgcttttataacttaatgcatggcaaaacgatg
caggtgattgaagcatcggaagacttactggtatttgcgcgaggaaaggaaggtatcgtg
gtgattaataaatcgaaacgccctcagaaagtacaaatagcagcaagtggtgaatggtta
gatttgctttccggtgagaaatatcaagctcagaaggggacgttaaacgttacagtgtcc
ggagaagaaagtttgatgctggtggctgaatga

DBGET integrated database retrieval system