KEGG   Vibrio cholerae O27 10432-62: VAB027_1830Help
Entry
VAB027_1830       CDS       T03829                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz00250  Alanine, aspartate and glutamate metabolism
vcz00410  beta-Alanine metabolism
vcz00430  Taurine and hypotaurine metabolism
vcz00650  Butanoate metabolism
vcz01100  Metabolic pathways
vcz01110  Biosynthesis of secondary metabolites
vcz01120  Microbial metabolism in diverse environments
vcz02024  Quorum sensing
Module
vcz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VAB027_1830 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAB027_1830 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VAB027_1830 (panP)
   00430 Taurine and hypotaurine metabolism
    VAB027_1830 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VAB027_1830 (panP)
Enzymes [BR:vcz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VAB027_1830 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: AKB05434
LinkDB All DBs
Position
complement(1953566..1955212)
Genome map
AA seq 548 aa AA seqDB search
MVSEHKSAQVNFDSLLKIFTVPEGPDSTLTKIDEELSRNLNHFLRKHIVAEEKPLKEIEK
DFSNAHIPEQPQFVSDHTQHLLDTLVSHSVHTASPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMIHRLIYGETDHFYQQWMHSAEHSLGAFCSGGTIANITA
LWVARNNALKAEGDFPGVEKAGLFKAMRHYGHEGLAILVSERGHYSLKKAADVLGIGQEG
LVAVKTDAHNRICPHDLEQKITELKANKIKVFAVVGVAGTTETGNIDPLRTIAQICQREQ
IHFHIDAAWGGATLMSNRYRGLLDGVELADSVTIDAHKQLYIPMGAGMVLFKDPNAMRSI
EHHAQYILREGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYQLLIDQSIEKARYFADL
IDAQTDFELVSQPELCLLTYRYLPAHVRMALEKSQGVQRAQLNELLNELTKFIQKKQRET
GKSFVSRTQLNPHQWDKLATIVFRVVLANPLTTKEILHNVLDEQREIAQQAPKLMRQIEH
LTQCILNQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacacaaatccgcgcaagtcaacttcgattctctgctcaagatcttcacc
gtcccggaaggtccagactcaacattaaccaaaatcgatgaagagctttctcgcaattta
aaccacttcttgcgcaaacacattgtggcagaagaaaagccgctcaaagagattgagaaa
gatttttccaacgcgcacattcccgaacagcctcaattcgtttccgatcatacccaacat
ttactggatactctggtgtcacactcagtgcacaccgcatcgcccagttttattggccac
atgacatcggcactgccctacttcctgatgccgctgtcaaaaattatgatcgctctcaac
cagaatctggtcaaaattgaaacctcgaaggcattcacgccgctagagcgtcaagtgcta
ggcatgatccatcgcttgatttatggcgagacggatcacttctatcaacagtggatgcac
agtgctgagcactcactcggcgctttctgctcaggcggaaccatagccaacattacggca
ctttgggttgctcgcaataatgcgcttaaagcagaaggcgatttccccggcgttgaaaaa
gcggggctcttcaaagccatgcgccactacggtcatgaaggtttagccattttggtttcc
gaacgaggccactactcgttgaaaaaagcggccgatgtgctgggtataggccaagaaggc
ttggtcgcggtcaaaaccgatgcgcataaccgtatctgcccacacgatctagagcagaaa
atcaccgagttaaaagccaataagatcaaagtgtttgccgttgtcggagtcgccggcacc
acagaaaccggcaatattgacccactgcgcaccattgctcagatttgtcagcgtgaacag
atccacttccatatcgatgcggcttggggcggcgcgacgttaatgtcaaaccgttatcga
ggactgcttgatggtgtcgagttggccgattcagtgaccattgatgctcataagcagctc
tacatccctatgggtgcgggtatggtcttgtttaaagacccgaatgcgatgcgctcaatt
gagcatcatgcccagtacattttgcgtgaaggctctaaagatttgggtagtcatacccta
gaaggatcacgctcaggcatggcgatgttggtttatgccagcatgcacatcattagccgc
ccaggctatcagctacttatcgatcaaagtattgaaaaagcgcgttattttgccgacctg
attgatgcgcaaactgactttgagttggtttcgcaaccggaactctgcttgttgacttat
cgatatttacccgcgcatgtccgcatggcgctagaaaaatcgcaaggggtacagcgtgct
cagttgaatgagctactgaacgaactcactaagtttattcagaagaaacaaagggaaacg
ggaaaatcctttgtgtcacgtacccagctcaatccacaccaatgggataaattggcaacc
atagtcttccgagtggtattggccaacccgctgacaaccaaagaaattttgcataacgtg
ctggatgaacaacgagaaatcgcgcaacaagcgccaaagttgatgcgtcaaatcgaacat
ctgacccaatgcattctgaaccaataa

DBGET integrated database retrieval system