KEGG   Vibrio cholerae O27 10432-62: VAB027_1988Help
Entry
VAB027_1988       CDS       T03829                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz00473  D-Alanine metabolism
vcz01100  Metabolic pathways
vcz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VAB027_1988 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VAB027_1988 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcz01011]
    VAB027_1988 (alr)
Enzymes [BR:vcz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VAB027_1988 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:vcz01011]
 Precursor biosynthesis
  Racemase
   VAB027_1988 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Lin0512_fam PapC_N
Motif
Other DBs
NCBI-ProteinID: AKB08346
LinkDB All DBs
Structure
PDB: 

Position
complement(2127876..2129099)
Genome map
AA seq 407 aa AA seqDB search
MHFKATLLSLSIAATLPSFSLSAAPLHIDTALPDAAQIQQSNSWLEISLGQFQSNIEQFK
SHMSANTKICAIMKADAYGNGIRGLMPTIIAQGIPCVGVASNAEARAVRESGFKGELIRV
RSASLSEMSAVLDLNIEELIGTHQQALDLAELAKQSGKTIKVHIALNDGGMGRNGIDMTT
EAGKKEAVSIVTQPSLSVVGIMTHFPNYNADEVRAKLAQFKESSTWLMQQANLKREEITL
HVANSYTALNVPEAQLDMVRPGGVLFGDLPTNPEYPSIVSFKTRVSSLHHVPKSSTVGYD
STFTTSRDSVLANLPVGYSDGYPRKMGNKAEVLINGQRAKVVGVTSMNTTVVDVTEIKGV
LPGQEVVLFGQQQKQSIAVSEMENNAELIFPELYTLWGTSNPRFYVK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcattttaaagccacgctgctttctctctctatcgcggcgactttgccttctttctct
ctctctgctgcgccattacacatcgacaccgctttaccggatgccgctcaaattcagcaa
agtaattcttggttggagattagcttaggccaattccaaagcaacattgaacaattcaaa
tcacacatgagcgccaacaccaaaatttgcgccatcatgaaagccgatgcttacggtaac
ggtattcgtggtttaatgccgaccattatcgcgcaaggcattccttgtgtgggggtggca
agtaatgcagaggcgcgtgcggtgcgtgaaagtggctttaaaggtgaactgatccgtgtg
cgctctgccagcctaagtgaaatgtccgcggtactcgatctcaatatcgaggagctgatt
ggtacccaccaacaagccctcgatctggcggagcttgccaaacaaagtggtaaaacgatc
aaagtccacattgcgctgaatgacggcggcatgggccgtaacggcattgatatgaccacg
gaagcaggcaagaaagaagccgtctctattgtgactcaaccttcgttgagtgtcgttggc
attatgacccacttcccgaattacaatgcggacgaagtgcgcgcaaaactggctcaattc
aaagagagctcaacttggctaatgcaacaagccaatttgaaacgtgaagagatcaccctg
catgttgcgaactcttacactgcgctcaatgtgccagaagcacaactggacatggttcgt
ccgggtggcgtgttgtttggtgatttgccaaccaaccctgaatacccatcgattgtttct
ttcaaaacacgtgtgtcttcgctgcaccatgtgccaaagagctcaactgtgggttatgac
agtacgtttactaccagccgtgacagtgtgctggcgaacctgcctgtgggttattctgat
ggttacccgcgcaaaatgggcaataaagccgaagtactgatcaatggacaacgcgccaaa
gtcgtgggagtgacatcgatgaacacgactgtggttgatgtgaccgagattaagggcgtg
ctccccggtcaagaagtggttctgtttggtcagcaacagaagcaaagcatcgcggtcagt
gagatggaaaacaacgctgagctgattttccctgagttgtatacgctgtggggaaccagt
aacccacgtttctacgtgaaataa

DBGET integrated database retrieval system