KEGG   Vibrio cholerae 10432-62: VAB027_2223Help
Entry
VAB027_2223       CDS       T03829                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vcz  Vibrio cholerae 10432-62
Brite
Enzymes [BR:vcz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VAB027_2223 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AKB06616
LinkDB All DBs
Position
complement(2410198..2410713)
Genome map
AA seq 171 aa AA seqDB search
MNKFTLFAVAAFFSSSVLAQDMTVVMTDLSSGQSVGTVTLTDSEYGTVFTPQLAGLPAGL
HGFHVHANGSCETSSKDGKTVLGGAAGGHYDPQNTGKHGYPWTNDNHLGDLPALYVDAQG
QANQPVLASRFKMAEVKGKALMVHAGGDNHSDHPMPLGGGGARIVCGVIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttactttgtttgcggtcgccgcgtttttctcttcttcggttttggcgcaa
gatatgaccgtggtgatgacggatttgagttctggccaatccgtgggcaccgttacctta
actgatagcgagtatggtacggtctttactccgcagttagctggcttgccagccggtttg
cacggttttcatgtacacgcgaatggctcatgtgaaacctcgtccaaagatggcaaaacc
gtattaggtggcgctgcgggtgggcattatgatccgcaaaacacgggaaaacacggctat
ccgtggaccaacgacaatcacttgggcgatctcccagctttgtacgtggatgcgcaaggc
caagcaaatcaacccgttttggcatcccgcttcaaaatggcagaggtaaaaggtaaagct
ttgatggtccacgcgggcggggataaccattccgaccatccaatgcccttgggtggaggt
ggtgcgcgaatcgtgtgtggtgtgattggtttataa

DBGET integrated database retrieval system