KEGG   Vibrio cholerae O27 10432-62: VAB027_2613Help
Entry
VAB027_2613       CDS       T03829                                 

Definition
(GenBank) beta-eliminating lyase family protein
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz00220  Arginine biosynthesis
vcz00250  Alanine, aspartate and glutamate metabolism
vcz00290  Valine, leucine and isoleucine biosynthesis
vcz01100  Metabolic pathways
vcz01110  Biosynthesis of secondary metabolites
vcz01130  Biosynthesis of antibiotics
vcz01210  2-Oxocarboxylic acid metabolism
vcz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAB027_2613
   00290 Valine, leucine and isoleucine biosynthesis
    VAB027_2613
   00220 Arginine biosynthesis
    VAB027_2613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vcz01007]
    VAB027_2613
Enzymes [BR:vcz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VAB027_2613
    2.6.1.66  valine---pyruvate transaminase
     VAB027_2613
Amino acid related enzymes [BR:vcz01007]
 Aminotransferase (transaminase)
  Class I
   VAB027_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKB07955
LinkDB All DBs
Position
2850334..2851548
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQYYQKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPTPDYPLWTAAVALSGGKAVHYICDEEADWYPDLDDIRSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIIEIARKHKLMIFADEIYDKVLYDGAVHTSIATLADDVLVVTFNGLSK
AYRVCGFRGGWMFLTGPKQQAQGYIAGLDMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGISCVKPKGAMYLFPKIDTKMYPIKDDQKMVLDFLVQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAISRFERFITTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctatgacattcgaggacca
gtgcttaaacatgctaaacgcatggaagaagaagggcataaaatactgaagcttaacatc
ggtaaccctgccccgtttggtttcgacgccccagacgagatcctagtcgatgtgatccgt
aacctacccacttcacaaggttactgtgactcgaaaggcatttattccgctcgtaaagcg
gtggtgcagtactaccagaaaaaaggtatccgcagtctggacgtcgaagatgtgtacatc
ggcaacggtgcatcagagcttatcgtgatggcgatgcaagccctgctcaacaatggcgat
gaaatgctggtacctacccctgattacccactgtggacagccgcggtagcactttctggc
ggcaaagccgtgcactacatctgtgacgaagaagccgattggtatcctgacctcgatgat
attcgcagcaaaatcaccccgaaaacccgtggcattgtgctgatcaaccccaataaccca
accggtgcggtttacagtcgtgatttcttgctggaaatcatcgagattgctcgcaagcac
aagctgatgattttcgccgatgagatttacgacaaagtgctgtacgacggcgccgtgcat
acctcaatcgccaccttagcggatgatgtattagtcgtcaccttcaacggcttatccaaa
gcttaccgtgtttgtggtttccgtggtggctggatgttcctgactggccccaaacagcaa
gcacaaggctatattgctggactcgatatgctggcctcgatgcgcttgtgtgccaacgta
ccaatgcaacatgcgattcaaacggcactcggcggctatcaaagtatcaatgagctgatt
ttgccgggcggtcgactgctggagcagcgtgatcgtgcatgggagctgattaaccagatc
ccggggatttcttgcgtgaagccaaaaggcgcgatgtacctgttcccgaaaattgatacc
aagatgtatccgatcaaagatgaccagaaaatggtgctcgatttcctagtgcaagaaaaa
gtgctgctggtacaaggcagtggttttaactggccaaaaccggatcacttccggattgtg
actctgccacatgtggaagatctggaaatcgccatcagtcgctttgaacgctttatcacc
acttacagccaataa

DBGET integrated database retrieval system