KEGG   Vibrio cholerae O27 10432-62: VAB027_2683
Entry
VAB027_2683       CDS       T03829                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vcz  Vibrio cholerae O27 10432-62
Brite
Enzymes [BR:vcz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VAB027_2683 (sodB)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: AKB05859
LinkDB
Position
2925833..2926417
AA seq 194 aa
MAFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFENKSLEEIIKTS
TGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGAVAEAINAAFGSFADFKAKFTDSAINNFG
SSWTWLVKKADGTLAITNTSNATTPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAQNLAK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcatttgaattacccgctcttccttatgcgaaagacgcactggaaccacacatctca
gcagaaactctggatttccaccacggtaagcaccacaacacttatgtggtaaaactgaac
ggtctgatcccaggtactgagtttgaaaacaaatcactagaagagatcatcaagacctca
actggcggtattttcaacaacgctgcgcaggtttggaaccacactttctactggcactgc
ctgtcaccaaacggtggtggcgagccaactggcgcagttgctgaagcaatcaatgcagca
ttcggttcttttgctgacttcaaagcaaaatttactgattcagccatcaacaacttcggt
tcatcttggacttggttggtgaaaaaagcggacggcactctggcaatcactaacacttca
aacgcaacaacaccactgactgaagaaggtgtaacccctctgctgacggttgacctgtgg
gaacacgcgtactacatcgactaccgtaacgtacgtccagattacatgaatggtttctgg
gctctggttaactgggacttcgttgctcagaacctagcaaaataa

DBGET integrated database retrieval system