KEGG   Vibrio cholerae O27 10432-62: VAB027_3079
Entry
VAB027_3079       CDS       T03829                                 

Definition
(GenBank) diguanylate cyclase domain protein
  KO
K20961  diguanylate cyclase [EC:2.7.7.65]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VAB027_3079
Enzymes [BR:vcz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VAB027_3079
SSDB
Motif
Pfam: GGDEF HAMP DUF4276
Other DBs
NCBI-ProteinID: AKB07547
LinkDB
Position
complement(3361536..3362828)
AA seq 430 aa
MTDQTRTSPLVNRLLKMISLCALGYLLIILAIIIPRGIQSVEQQKQELEEKLALSLSNSA
AIALYVNNYDIASEVMDALLLHQEINAVKLASVDGIVFERTTIPSTYKEQNYWSDANRYR
LDSPVDGNLIGYLMIHEDHQVIRQQAINQILDQIAVVLIQFLVTFIALIWIVRRLVGKPL
TDLSQALSEVRPDHDRKVAVAAEDHHNEIGLVAKSINEFIDASHQALLRERELRQQIERW
ESYYRTIAEQDTLTGLKNRLGCEKFVLRKQRASTTMVLLLIDLDGFKQVNDTLGHAAGDE
VLREIAKRFYALAQTHFSDFVVGRLGGDEFAIYIPLDEFVAESIERFAAQLIESSSEPIA
LGQQSAQVGCSIGISHMNSLHIDLEKLLLQADKAMYWVKYRGKHGYHIYRMGEEILPLPS
AKELKQDQFR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgactgatcaaacgcgcacttcgccactggttaatcgcttgctgaagatgatttcactg
tgtgcacttgggtatttgctgatcattttggccatcattattccgcgcggcatacagagt
gttgagcagcaaaaacaagagctggaagagaagcttgcgctctccttgagtaactcggcg
gccattgcactgtatgtgaataattacgatattgcctccgaggtgatggatgcgttgctg
cttcatcaagagatcaatgcggttaagttagccagcgtggatggcattgtctttgagcgc
accaccatcccctcaacctacaaagagcagaattattggagtgacgcgaaccgctaccga
ttagattctcccgtagatggtaatttgattggctatctgatgattcatgaggatcatcag
gtgattcgtcagcaagccattaatcagattcttgatcagatagccgtggttttgatccag
tttctcgtgacttttattgcgcttatctggatcgttcgccgcttggtcggtaaacccctg
acggatctttcacaggcgttatccgaagtgcggccagatcatgatcgcaaagtggcggta
gccgcagaagatcaccacaacgagattggtttggtggccaaaagcatcaatgaatttatc
gacgcttcccatcaagctttactgcgtgaacgcgagctgcgtcaacagattgaacgttgg
gaaagctactatcgcaccattgccgaacaagacacgctgacgggactaaaaaaccgttta
ggttgtgagaagttcgtgctccgcaaacagcgtgctagcaccaccatggtactgctattg
attgatttggatggttttaagcaggtgaatgataccttggggcatgcggctggcgatgag
gtattacgtgaaatcgccaaacgtttttatgccttggcgcaaacgcacttttctgatttt
gtggtcggacggctcggtggcgatgagtttgctatttacattccgctggatgaattcgtt
gccgaatctatcgagcggtttgccgctcagttgatcgaatcctcctctgagccgattgca
ttgggtcagcagagtgcgcaagtgggttgcagtatcgggattagtcatatgaacagtctg
cacattgacttagaaaaactgctgctacaagccgataaagccatgtactgggtcaaatac
agaggcaaacatggctatcatatttatcgaatgggggaagagatcctgcctcttcccagt
gcgaaagaactcaagcaggatcagttcagatag

DBGET integrated database retrieval system