KEGG   Vibrio cholerae O27 10432-62: VAB027_578Help
Entry
VAB027_578        CDS       T03829                                 

Definition
(GenBank) hypothetical protein
Organism
vcz  Vibrio cholerae O27 10432-62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_5 GST_N_4 Glutaredoxin LytTR
Motif
Other DBs
NCBI-ProteinID: AKB07297
LinkDB All DBs
Position
648893..649504
Genome map
AA seq 203 aa AA seqDB search
MKLYETAMMPSCRRVSIFLKELGIDVERVQVDVRGGENLSDTFKSKSLNGKVPLLELDEG
TTLCESVAICRYFDLTYPNTHKLFGDSALEQAQVEMWHRVVEFQGLYAGFQAFRNLSGIY
KDREHCVYAWGEESKARVAALLPQLEQRLTQSRFIAADRFTIVDITAYIFIGFAQKALEL
PVFEHYPHITRWFEQLSQRPAFQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgaaaccgcgatgatgccaagctgtcgcagagtctcgatttttcttaaa
gaattaggcattgatgttgagcgtgttcaggtggacgttcgtggtggtgaaaacttatcg
gatacctttaaaagcaaaagtctgaacggcaaagtgcctctgcttgaactggatgagggt
acaacactgtgtgaaagtgtggcgatttgtcgctatttcgatcttacctatccaaatacg
cacaagttgttcggggattcagcattagaacaagctcaagttgaaatgtggcatcgagtg
gttgagtttcaaggcttgtatgcaggatttcaggcgtttcgaaatctaagcggtatctat
aaagatcgtgaacactgcgtttacgcgtggggtgaagagagcaaagcacgcgtggcagcc
cttttaccacaacttgagcagcgattgacacagtcgcgatttattgccgcagatcgtttc
accattgttgatattaccgcctacatttttattggtttcgcccaaaaagcgctcgaactt
cctgtgtttgaacactatccgcacatcactcgttggtttgagcaactctcgcaacgacca
gcttttcaataa

DBGET integrated database retrieval system