KEGG   Vibrio cholerae O27 10432-62: VAB027_590Help
Entry
VAB027_590        CDS       T03829                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vcz  Vibrio cholerae O27 10432-62
Pathway
vcz00473  D-Alanine metabolism
vcz00550  Peptidoglycan biosynthesis
vcz01100  Metabolic pathways
vcz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vcz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VAB027_590
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAB027_590
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VAB027_590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vcz01011]
    VAB027_590
Enzymes [BR:vcz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VAB027_590
Peptidoglycan biosynthesis and degradation proteins [BR:vcz01011]
 Precursor biosynthesis
  Amino acid ligase
   VAB027_590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_YheCD Glutaminase ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AKB05266
UniProt: A0A3A4AJC0
LinkDB All DBs
Structure
PDB: 

Position
662459..663463
Genome map
AA seq 334 aa AA seqDB search
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFHVIRVEMKKEGWFSEQGALVYLD
TNSATLNSDKASYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALDIPNTPYLFLTQNTPSSIEKAKQAFGHWGSIFVKAARQGSSVGCYKVTTEDQI
APAIEAAFGFSEQVLVEQAVKPRELEVSAYEMNGQLYISKPGEVIAPEGTFYSYEEKYSA
NSHARTVLEAENLTEKHKELIQTYAERVFIHMKLRHLSRIDFFLTQEGQIYLNEVNTFPG
MTPISMFPKMLEHNGHRFSEFLAQCVTNTLVNAK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacaacaatcctacttttgtgcggtggcggctcatctgagcacgaaatttct
ctcgtatcagccaactacatccaacaacagcttgaactgactccagagtttcacgtgatt
cgagtcgagatgaaaaaagagggatggttttccgaacaaggagccctcgtatacctcgat
acaaatagtgcaacattaaatagcgataaggcttcctacccaatagattttgttgttcct
tgcatccatggtttcccgggagaaactggggatattcaatccatgttagaactggcaggc
attccttatctaggctgtgggccagaagccagtgcaaacagctttaacaaaatcacgtcc
aaactgtggtatgacgcattagatattcctaacacaccgtatctatttttaacccaaaat
acaccaagctcgattgaaaaagccaagcaagcttttggtcattggggaagtatctttgtc
aaagctgctcgtcagggttcttcagtcggatgctacaaagtaaccacagaagatcagatt
gcccccgccattgaggctgcttttggtttctcagagcaagttcttgtcgagcaagccgtt
aaacctagagagttagaggtttctgcttatgagatgaacggacaactctatatctcaaag
ccgggagaagtgattgcaccagaaggtacattctattcatatgaagaaaagtacagtgcg
aatagccacgccagaaccgtcttagaagctgaaaatctaaccgagaaacacaaagaatta
attcaaacatatgctgaacgtgtattcatccatatgaagcttcgtcatttatctcggatc
gactttttcttgactcaagagggacaaatttacctcaatgaggttaatacatttccagga
atgacaccgatttccatgtttccgaaaatgctagagcacaacggacaccgatttagtgaa
ttcctcgcgcaatgtgtcaccaacacattagtaaatgcgaagtag

DBGET integrated database retrieval system