KEGG   Verticillium dahliae: VDAG_00408Help
Entry
VDAG_00408        CDS       T03450                                 

Definition
(RefSeq) glucoamylase P
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
vda  Verticillium dahliae
Pathway
vda00500  Starch and sucrose metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDAG_00408
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     VDAG_00408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 20701871
NCBI-ProteinID: XP_009650080
UniProt: G2WS75
LinkDB All DBs
Position
2
AA seq 622 aa AA seqDB search
MVSLRSQLVALAAALAIPAVSGQDLEDFIAKQRPLSLTNVLNNLGAAAGAAPGLVIASPS
RTDPPYYYTWTRDSALTFKMLIDEFIHDPVANANLEKHIRDYLRAQAILQTVANPSGALL
PSGRGLGEAKYEVDGSRFNGAWGRPQRDGPPLRAVALITWANWLADSGDEGEEEARDIVW
PVIANDLAYTGQYWNSTGFDLWEEVSGSSFFTTQAQYRALIEGAELAERLNTTCGPACAE
APAVGCFLNSDSYWNGRHHIANINTNTQRSGKDANTMLGANAAFDIAASCDSATIQPCHP
RALASFKQWVDAWRDPAEYPINEGIPSNEGIAIGRYTEDIYYNGNPWYLITLGAGEFLFN
AAHQWKAHGYITIDSTSLPFFQDLWPEAKVGTFKRPCSKNPKAPFNVIVEAANRYGDSFL
SVAQKYTPADGSLAEQYNRDPPFEPQSARDLTWSYAAFVTAAARRAGEFPPTWVPAKLPI
PSTCAASSARGTYTPATAAGAPDLGEVPCAAPVTFRVDARTYYGEDIYVVGGAPSLGNWN
VENAQPLTADGYTDARPLWAIDVDLDAAGQTVTYQFVRRQNCGQGYIYETVNRTVDVPAC
GVTTPTVLEATWTGPVGTPGNC
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggtctctctccgctcccagctcgtggctctggccgctgccctggccatccccgccgtc
tctggccaggacctcgaggacttcatcgccaagcagcgtcctctgtcactgaccaatgtt
ctcaacaaccttggtgccgctgccggcgccgcccccggcctggtcatcgcaagcccctcc
aggaccgaccctccctactactacacttggacccgtgactcggccttgaccttcaagatg
ctcatcgacgagttcatccacgaccctgtcgccaatgccaacctcgagaagcacattcgt
gactaccttcgcgcccaggccatcctacagactgtcgccaacccctccggcgccctgctg
ccctccggccgcggtctcggcgaggccaagtacgaggttgacggctcgcgcttcaatggc
gcctggggtcgcccccagagggacggaccccctctgcgcgccgtcgccctcatcacctgg
gccaactggctcgccgattcgggcgacgagggcgaggaggaggcgagggacatcgtctgg
cccgtcattgccaacgatctcgcctacacgggacagtactggaactcgaccggcttcgac
ctctgggaggaggtctccggctccagcttcttcaccacccaggctcagtaccgcgctctg
atcgagggtgccgagctcgctgagcgcctcaacacgacgtgcggccccgcctgcgccgag
gcccctgccgtcggctgcttcctcaactcggacagctactggaacggccgtcaccacatt
gccaacatcaacaccaacacccagcgctccggaaaggacgccaacaccatgctcggcgcc
aacgccgcctttgatatcgccgcctcctgcgacagtgccaccattcagccctgccaccct
cgcgccctggcgtctttcaagcagtgggttgacgcctggcgtgatcctgccgaatacccc
atcaacgagggtatccccagcaacgagggcattgccatcggccgctacaccgaggacatc
tactacaacggcaacccttggtatctcatcaccctcggtgctggcgagttcctcttcaac
gccgcccaccagtggaaggcccacggctacatcaccattgacagcacctcgctgcccttc
ttccaggacctctggcccgaggccaaggttggtaccttcaagcgcccctgctccaagaac
cccaaggctcccttcaacgtcattgtcgaggctgccaaccgctacggcgattcgttcctc
tctgtcgctcaaaagtacaccccggccgacggctccctcgccgagcagtacaaccgtgac
cctcccttcgagccccagagcgcccgcgacctgacctggtcctacgccgcctttgtcacc
gccgccgcccgccgcgccggcgagttcccccccacctgggtccccgccaagctgcccatc
ccctcgacctgcgccgcctcgtccgcgcggggcacctatacccctgccaccgccgctggc
gcgcccgacctcggcgaggtcccctgcgctgcgcccgtcaccttccgtgtcgacgccagg
acctactacggcgaggacatctacgtcgtcggcggtgcgccgtctctcggcaactggaac
gtcgagaacgcccagcccctgaccgccgacggctacaccgacgcccggccgctctgggcc
atcgacgtcgacctcgacgccgcgggccagactgtcacctaccagtttgtgcgcaggcaa
aactgcggccaaggctacatttacgagacggtcaacaggaccgtcgacgtgccggcgtgc
ggtgtcacgacgccgaccgtcctcgaggccacgtggaccggccccgtgggtacgcctgga
aactgctag

DBGET integrated database retrieval system