KEGG   Verticillium dahliae: VDAG_00947Help
Entry
VDAG_00947        CDS       T03450                                 

Definition
(RefSeq) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
vda  Verticillium dahliae
Pathway
vda03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:vda00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    VDAG_00947
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vda03400]
    VDAG_00947
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     VDAG_00947
DNA repair and recombination proteins [BR:vda03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     VDAG_00947
 Prokaryotic type
     VDAG_00947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-GeneID: 20702410
NCBI-ProteinID: XP_009648128
UniProt: G2WT24
LinkDB All DBs
Position
1
AA seq 386 aa AA seqDB search
MTSTLKRKAGDTPAASDAKKPKQNGNITSFFGAPKPVPGAAKAAAAPEAPAAKFDKAKWV
AGLTPEQKDLLKLEIETLHESWLGLLKDEVTSKEFLDLKRFLNRETEMGRKWFPPKEDVY
SWSRHCPFNQVKVVILGQDPYHNINQAHGLAFSVRAPTPAPPSLKNMYIALKRDYPTFTP
PPNKAGLLTPWADRGVLLLNTCLTVRAHEANSHSNRGWERFTQRVIDLVAARRTRGVVFL
AWGTPAGKRVLKVDQKRHLVLKSVHPSPLSASRGFFDCGHFKKSNEWLVQRYGDEAEIDW
DLGGGGSTLSAAAKKAVAVKPAETPVMEEAKTKATEEDDGEEADEAEEEAMAQALAEAEA
KAQTQLKNEAKADGTNGDVTGVEPKE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcacactcaagcgcaaggccggcgacacgcctgccgcctcagacgccaagaag
ccgaagcagaacggcaacatcacctcctttttcggcgcccctaaacccgtccccggcgcc
gccaaagccgcagccgctcccgaggcaccggcagcaaagttcgacaaggcgaaatgggtc
gccggtctgacgcccgagcagaaggacctgctgaagctcgagattgagacgctgcacgag
agctggctgggtttgctcaaggacgaggtgacgagcaaggagtttctcgacctcaagcgg
ttcctcaaccgcgagacggagatgggacgcaagtggtttccgcccaaggaagacgtctac
tcatggtcccgccactgcccgttcaaccaggtcaaggtcgtcatcctcggccaggacccc
taccacaacatcaaccaggcccacggcctcgccttctccgtccgggccccgacgccggcg
cccccgtccctcaagaacatgtacatagccctgaagcgcgactacccgaccttcacgccg
ccgcccaacaaggcgggcctgctgacgccgtgggcggaccgcggcgtgctgctgctcaac
acgtgtctaacggtgcgcgcgcacgaggccaacagccactcgaaccgcggctgggagcgc
ttcacgcagcgcgtcatcgacctcgtcgccgcccggcgcacgcgcggcgtcgtcttcctg
gcctggggcacgcccgccggcaagagggtgctcaaggtcgaccagaagaggcacctcgtg
ctgaagagcgtgcacccgagcccgctgagcgcgtcgcgcggcttcttcgactgcgggcac
tttaaaaagtcgaacgagtggctcgtccagaggtacggcgacgaggccgagattgactgg
gatctcggcggcggcggcagcacgctgagcgctgccgcgaagaaggcggtcgctgtgaag
cctgccgagacgcccgttatggaggaggcgaagacgaaggcgacggaggaggacgatggc
gaggaggcggacgaggctgaggaggaggccatggcgcaggctcttgctgaggccgaagcc
aaggcgcagactcagctgaagaatgaggccaaggctgatggcacgaacggagatgtcacc
ggggttgagcccaaggagtag

DBGET integrated database retrieval system