KEGG   Verticillium dahliae: VDAG_01555Help
Entry
VDAG_01555        CDS       T03450                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
vda  Verticillium dahliae
Pathway
vda00052  Galactose metabolism
vda00500  Starch and sucrose metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VDAG_01555
   00500 Starch and sucrose metabolism
    VDAG_01555
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     VDAG_01555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 20703018
NCBI-ProteinID: XP_009648736
UniProt: G2WSF2
LinkDB All DBs
Position
1
AA seq 895 aa AA seqDB search
MHYWKTLLVPGVAAAAVLKRDSPDYDKLADCPGYAASNVKTTGNGLTAELKLAGPACNTY
GTDLEELTLSVTYESESRIHVKIQDPADQVYQVPESVFPRPDEGSFSGDAKIKFDYTEEP
FAFTIKRSDTDEVLFDTSAASIVFESQYLRLRTSLPEDPYLYGLGEHTDPFRLNTTNYIR
TLWNRDSYGVPYGSNLYGSHPFYIEQRETGTHGVFLLNSNGMDVMVNKDDAGQYLEYNTL
GGVLDFWFLSGPSPVDVVKQYSDIVGLPSLQPYWGLGFHQCRYGYRDAFDVAEVVYNYSQ
AGIPLETMWTDIDYMDARKVFTLDPRRYPIEKVRQIVDYLHEHDQHYIVMVDPAVAYEES
DIVNRGRRDDIWLQHPNGSEYLGVVWPGVTIFPDWFAENITKYWNNEFDIFFDKDTGVDI
DGLWIDMNEPANFCNGLCDDPFGDAVGYPPEPPAVRENPRALPGFGCEFQLPGACDGSAE
RRQIEAHPARPRAAGAETSSLEVRQTGSGDRKGLPDRDLLYPKYAIHNDAAGPDVSWNAD
RGGLSFKTVKTDIAHQNGLVMYDTHNLYGAMMGQGHVPPATGKAVGHWLGDNLSQWDHYR
FAIYTTMTFSALYQFPMAGSDVCGFGGDATEQLCARWASLGAFFTFYRNHNGIDSISQEF
YRWPAVAESARKAIDIRYRLLDYIYTAIYKATVDGSPTLNPMYFVYPEDRATWALQHQFF
YGDAVLVAPVTEQDATSVDVYLPKDTFYDWYTHRPVRGKGALHTFEDQDVTDIPLLIRSG
KILPLRVASANTTTALRQNDFELLVTLDVDGQASGALYLDDGVSLVQQGHTLIDFTFENG
VLSLDGTFGYEVDVKIVKVKVLGASCRTGAGKEGRGSKTVKVDLSLNKAGSVKVW
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgcattactggaagaccctgctcgttcccggtgtggccgcggcggccgtgctcaagagg
gactctccagactacgacaagcttgccgattgtcccggctatgctgcctcgaacgtcaag
acgaccggcaacggtttgactgccgagctgaagctcgctggcccggcttgtaacacgtac
ggcaccgacctcgaggagcttactctgtcggtcacctacgagagcgagtcccgtattcac
gtcaagatccaggaccctgcggaccaggtttaccaggtccccgagtctgtcttcccccgg
cccgacgagggctccttctcgggtgacgccaagatcaagtttgactacaccgaggagccc
tttgccttcaccatcaagaggtcggatacggatgaggttctcttcgacacctcggccgcc
tcgatcgtcttcgagtcgcagtacctccgcctgaggacgagcctgcccgaggacccttac
ctctacggcctcggcgagcacaccgaccccttccgcctcaacacgaccaactacatccgc
acgctgtggaaccgtgacagctatggtgttccgtacggcagcaacctgtacggcagccac
cccttctacatcgagcagcgcgagacgggcacccacggcgtcttcctcctcaactcgaac
ggcatggacgtcatggtcaacaaggacgacgccggtcagtacctcgagtacaacacgctc
ggtggcgtgctcgacttctggttcctctccggtccctcgcccgtcgacgtcgtcaagcag
tactcggacattgtcggtctgccctcgctccagccctactggggtctcggcttccaccag
tgccgctacggctaccgcgacgcctttgacgtcgccgaggtcgtctacaactacagccag
gccggcatccccctcgagaccatgtggaccgacattgactacatggacgcccgcaaggtc
ttcaccctcgacccccgccgctaccccatcgagaaggtccgccagatcgtcgactacctc
cacgagcacgaccagcactacattgtcatggtcgacccggccgtcgcctacgaggagtcg
gacattgtcaaccgcggccgtcgggacgacatttggctgcagcaccccaacggctccgag
tacctcggcgtcgtctggcccggcgtcaccatcttccctgattggtttgccgagaacatc
accaagtactggaacaacgagtttgacatcttcttcgacaaggatacgggtgtcgacatt
gacggtctgtggatcgacatgaacgagcccgccaacttctgcaacggtctctgcgacgat
ccctttggcgacgccgtcggctacccgcccgagccccccgccgtccgcgagaacccccgc
gccctgcccggcttcggctgtgagttccagctccccggtgcctgcgacggcagcgccgag
cgccgccagatcgaggcccaccccgcccgcccccgtgccgccggcgccgagacgtcttcg
ctcgaggtccgccagaccggctcgggcgaccgcaagggtctccccgaccgcgacctcctg
taccccaagtacgcgatccacaacgacgcggcggggcccgacgtgtcgtggaacgcggac
cgcggcggcctctcctttaagacggtcaagacggacattgcgcaccagaacggcctcgtc
atgtacgacacgcacaacctctacggcgccatgatggggcaaggccacgttcccccggcg
acgggcaaagccgtgggccactggctcggcgacaacctctcgcagtgggaccactaccgg
ttcgccatctacacgaccatgaccttctcggcgctctaccagttccccatggccggctcg
gacgtgtgcggcttcggcggcgatgccaccgagcagctctgcgcgcgctgggcctcgctc
ggcgccttcttcaccttctaccgcaaccacaacggcatcgactccatctcgcaggagttc
taccgctggcccgccgtcgccgagtcggcccgcaaggccatcgacatccgctaccgcctg
ctcgactacatctacacggccatttacaaggccaccgtcgacggcagcccgacactgaac
cccatgtactttgtctaccccgaggaccgcgccacctgggccctgcagcaccagttcttc
tacggcgacgccgtcctcgtcgcccccgtcaccgagcaggacgccacgagcgtcgacgtc
tacctgcccaaggacaccttctacgactggtacacccaccgccccgtccgcggcaagggc
gccctgcacacctttgaggaccaggacgtcaccgacatcccgctgctcatccgctccggc
aagatcctgccgctgcgcgtcgcctcggccaacacgacgacggcgctgcgccagaacgac
tttgagctgctcgtcaccctcgacgtcgacggccaggccagcggcgcgctgtacctcgac
gacggcgtgtcgctcgtccagcagggccacaccctcatcgactttacctttgagaacggc
gtgctctccctcgacggcacctttggctacgaggtcgacgtcaagattgtcaaggtcaag
gtcctcggcgcctcgtgccgcaccggtgcgggcaaggagggccgcggcagcaagacggtc
aaggttgacctgtcgctgaacaaggcgggctccgtcaaggtgtggtga

DBGET integrated database retrieval system