KEGG   Verticillium dahliae: VDAG_01819Help
Entry
VDAG_01819        CDS       T03450                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vda  Verticillium dahliae
Pathway
vda00250  Alanine, aspartate and glutamate metabolism
vda00410  beta-Alanine metabolism
vda00430  Taurine and hypotaurine metabolism
vda00650  Butanoate metabolism
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
Module
vda_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vda00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VDAG_01819
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VDAG_01819
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VDAG_01819
   00430 Taurine and hypotaurine metabolism
    VDAG_01819
Enzymes [BR:vda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VDAG_01819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 20703282
NCBI-ProteinID: XP_009656143
UniProt: G2WW33
LinkDB All DBs
Position
7
AA seq 559 aa AA seqDB search
MSLATHVDPDEIIQRLQASHITAPGHTNLNSQGRAAHIHPFDTQYSSQENIPKFKIPQDG
APADTVYHMVRNQLDLDGKPNLNLASFVSTFLEPNAQQLMEENLTKNLADSDEYPAMMEI
HQRCISIIAHLWGVQPGERAIGSACTGSSEAIHLGGLAMKRRWQEKRKAEGKDTSKPNII
MGANAQVALEKFARYFEVEARILPVSAESRFRLDPELVKENIDENTIGVFVILGSTYTGH
YEPVEEISKILDDYEAKTGVDIPIHVDAASGGFIAPFTDAGAGGAKWNFELPRVKSINTS
GHKFGLVSAGLGWIIWRDEAYLPEFLVFELHYLGGTEKSYTLNFSRPGAQVVVQYYNLVH
LGFSGYRGIMENCLTNARLLANSLEETGWYTVVSDIHRRVDGGSDRAPKSGTEGAEQEPP
RETSADYVAGLPVVSFRLTDEFQKQYSHIKQETVSLFLRAKGWIIPNYALPPSEEKTEIL
RVVVRENMTFDLLELLLTDIVTVTETLIEDDKVDLSSLKRHHIGHGRRPVTKQDHERHKR
RLEGHGKKRPQDGIHRTVC
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgcaacccacgtcgacccggatgagatcatccagcgactccaggcgtctcac
atcaccgcaccaggccacactaatctgaacagccaagggagagctgcccacatccaccca
tttgacacccaatattcgagtcaagaaaacatccccaagttcaagattcctcaagatggt
gccccagctgatacggtctaccacatggtgaggaaccagctggatctcgatggcaagcca
aacttgaacctcgccagcttcgtcagcacgttcctcgagccgaatgcccagcaattgatg
gaggagaacttgacgaagaatctggctgactcggacgagtatccggccatgatggagatc
catcagcgatgcatcagcatcattgctcacctctggggcgtacagcccggtgagagggca
attggttccgcctgcacaggttcttctgaagccatccatcttggcggcctcgccatgaaa
cgcagatggcaggagaagcgaaaggctgaaggcaaggacacatccaagcccaacattatc
atgggcgccaacgcacaagtcgccctggagaagtttgctcggtatttcgaagtcgaggcc
cgtatcctacccgtcagcgcggaaagccgcttccgtcttgatccggagctggtaaaggag
aacattgacgagaacacgattggcgtatttgtcatcctcggaagcacttacacaggtcat
tacgagccggtcgaagaaatctcgaagattcttgacgactatgaggcaaagacgggtgtt
gatattccaatccacgtcgatgctgcttctggcggcttcatcgctccattcaccgacgct
ggtgccggtggcgccaagtggaactttgaacttcccagagtcaagtccatcaatacttcg
ggtcacaagtttggtcttgtgagcgcaggcctcggctggatcatctggcgggacgaagcc
taccttcccgaattcctcgtctttgagttgcactatctcggtggcaccgaaaagtcttac
acactgaacttttcccgacctggtgcgcaggttgtcgttcaatactacaaccttgtgcat
cttgggttctccgggtaccgcggtatcatggagaattgtctcacaaatgcgcgcttgctg
gccaacagtttggaagaaacaggctggtatacggtcgtatccgatattcaccgtcgcgtc
gatggcggatccgacagggcacccaagtcgggaactgagggcgctgaacaagagcccccc
cgcgagacctcggcggattacgttgctggcctgcccgtcgtttcattccgtctcaccgac
gagttccagaagcagtacagccacatcaaacaggagacagtgtcgctgttcttgcgtgcc
aagggttggatcattcccaattacgcgctgccgcccagcgaggagaagacggaaatcctg
cgagtagtcgttcgtgaaaatatgaccttcgacctcttggagctcctgcttaccgatatt
gtgacggttacggagacgctcattgaggacgacaaggtcgatctatcctcgctgaagcgg
catcacattggccacggcaggcggcccgtcaccaagcaagatcacgagaggcacaagcgc
agacttgagggtcacggtaagaagaggccgcaggacggcattcacaggacggtgtgttag

DBGET integrated database retrieval system