KEGG   Verticillium dahliae: VDAG_01953Help
Entry
VDAG_01953        CDS       T03450                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
vda  Verticillium dahliae
Pathway
vda00500  Starch and sucrose metabolism
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VDAG_01953
Enzymes [BR:vda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     VDAG_01953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 20703416
NCBI-ProteinID: XP_009656277
UniProt: G2WWG7
LinkDB All DBs
Position
7
AA seq 632 aa AA seqDB search
MSFFHGLTLEAFPANLTSSLAQPFMSYLSSALLLGSVAVQHILGNIAATPPASDLESFIQ
RQYPIAYDGVLCNIGSEGCQAQGSSPGVVIASPSREDPPYFYTWTRDSGLVFKSLVDIFV
DKFDPALQDKIQQYVASSAQLQGVSNPSGELWNGEGLGEAKFNVDLTAFTGDWGRPQRDG
PALRAIAIIGYAKWLVSNGHASTAEDVLWPVVQNDLAYVAQYWNQTGFDLWEEVYGSSFF
TVASQHRALVEGASLARTLGFQCKSCEAIAPHILCFMQSFWSPSAKHILANSSIHTFDPF
AGCDAATFQPCSDRALASHKAIVDSFRSLYSINDGISPSSAVAIGRYPEDVYYGGQAWYL
TTLAAAEQLYDALLVWKLQGSITVTEVSLSFFQPHLPSITTGTYDNQTSAYASLTDAILT
YADGFVKVVANFTPVDGTLDEQFDRNTGEPLSARDLTWSYASFLTAIRRRAGLESPGWIN
ADATLIPATCSATSVFGVYATATATTFPSNLVPGTPPSETPPLKLPRPSTCLVRFKERVS
TRVGQNIRVVGNQPGLGRWDPGHAVPLDALQYTATDPSWRVTIALPAGQVVEYKYVMVES
GGSVVWEAGSNRVLTVPSECEGELERSDEWQS
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctttcacggcctcactctcgaggcattcccggccaacctcaccagttccctc
gcacagcccttcatgtcgtacctgtcgtctgccctccttctaggctctgtcgccgtgcag
cacatcctaggcaacatcgccgccaccccaccagcatctgatctcgagtccttcatacaa
aggcagtatccgatcgcctatgatggagtgctgtgtaacattgggtctgaaggttgccag
gcacaaggctcaagccctggtgttgtaattgcatccccgagtcgggaggatccgccatac
ttttacacttggacacgggatagcggactagtattcaagtcactcgtggacatcttcgtc
gataagtttgatcctgccctgcaagacaagatccaacagtacgtggcgtcttcggctcag
ctacagggcgtcagcaatccatccggcgagctctggaacggagaaggactcggcgaagcc
aagttcaacgttgatcttacggcattcacgggagactggggacggccacagcgtgatggg
cctgcactgcgcgctattgccatcatcggatatgccaagtggctcgtcagtaatggacat
gcttcgacagctgaagacgtattatggcccgttgtccagaatgacctcgcctatgttgcc
caatactggaaccaaacgggcttcgacctctgggaggaagtttatggaagctcgttcttt
acggtagcgagccagcacagagctctcgttgagggtgcctcgcttgctcgaacccttgga
tttcaatgcaagtcttgtgaagccattgcccctcatatcctatgcttcatgcaatccttt
tggtcaccatcagccaaacacatccttgcgaacagttctatccacactttcgaccctttt
gctggctgtgatgctgcaacattccagccctgcagtgatagagctttggcaagccacaag
gcaatagttgattccttccgctccctgtacagcatcaatgacggtatctccccctcgtcc
gctgtagcgatcggtcggtatccagaagatgtgtattatggcggccaggcatggtacctc
acgacactggcagctgctgagcaactctatgacgctctccttgtctggaagcttcaagga
tccatcactgtcacagaggtctccctatcatttttccaaccccatctgccctctatcacc
acaggcacctatgataaccagacgtcagcctatgccagcttgacggatgccatcttaaca
tatgcagatggattcgtcaaggtcgtggccaactttacgccagtcgatggaacgctggat
gaacaatttgaccgcaatactggcgagcccctttcagcgcgggatcttacttggtcttac
gcgtctttcctgactgccatcaggcgacgagctggccttgagtctcctggctggatcaac
gcagatgctactctgatcccggcgacttgctcagcaacgtcggtctttggcgtatatgcc
acagcgacggcaacaaccttcccgtcaaacctagtccccggcacaccgccctcggaaacc
ccccctctcaaactgccaagaccctcaacctgtctagtcaggttcaaagagcgtgtatcc
actcgggtagggcagaacatacgggtcgtcggaaaccagccgggtttgggaagatgggat
cctgggcatgccgtgcctttggacgccttgcaatacacggccacggatccgtcgtggcgc
gtgacaatcgctctgccggcgggtcaagtggtagaatacaaatatgtgatggttgaaagt
ggtggctccgtggtctgggaagcaggcagcaaccgagtgttgacggtacccagcgagtgt
gagggggagctggagaggtctgatgagtggcagagctga

DBGET integrated database retrieval system