KEGG   Verticillium dahliae: VDAG_02087Help
Entry
VDAG_02087        CDS       T03450                                 

Definition
(RefSeq) glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vda  Verticillium dahliae
Pathway
vda00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vda00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VDAG_02087
Enzymes [BR:vda01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VDAG_02087
Transporters [BR:vda02000]
 Other Transporters
  Pores ion channels [TC:1]
   VDAG_02087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 DUF1508
Motif
Other DBs
NCBI-GeneID: 20703550
NCBI-ProteinID: XP_009656411
UniProt: G2WUU6
LinkDB All DBs
Position
7
AA seq 265 aa AA seqDB search
MSVTSPSAKRTKTAKDVSYNLIYWPGVPGRGEHVRLVLEEAGASYTDTAAAENGIDEVLK
HTADTNTGDASNPPPFAPPILKHGDLLISQVPNILQYLGIRHGLAPKPGDENDGVYHVNQ
LALTALDGLSNEVHDTHHPIATGLTYEDQKEESKKRAKDYVENRLPKFLGYFERVLKGEA
SGEGPWLYGGSLTYADLVLFQCIDGVKFAFPKALAKLEDSSRFNGVFKLYDAVKERPKIK
EYLASERRQKYGDGIYRHYPELDSE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttacatctccctctgcgaagcgaacaaagacggccaaggacgtctcctacaac
ctcatctactggcctggcgttcccgggcggggagagcatgttcgcctcgtccttgaagaa
gctggagcctcatatacagacactgcagcagctgaaaatggaatcgacgaggttttgaag
cataccgccgacaccaacacaggggacgcctcgaatcctcctcctttcgcaccgccaatc
ctgaaacacggcgaccttctcatctcacaggtgcctaacattctccagtacctcggaatc
cgtcacggcctagcacccaagcccggagatgagaatgacggggtttatcacgtcaaccag
ctagctctaacggcgctagatggcctgagcaatgaggtccacgacacacaccaccccatc
gccacgggcctcacttatgaggaccagaaggaggagtcaaagaaaagagcaaaggactac
gttgagaaccgacttcccaagttccttggctactttgagcgcgtcctcaagggtgaggcc
agcggagagggaccgtggctgtatggcgggtcgctcacgtacgctgatctggtcctcttc
cagtgcatcgacggcgtcaaattcgccttccccaaggcattggccaaactggaggacagt
agcagatttaatggggtcttcaagctctacgatgctgtcaaggaacgccccaagattaag
gaatacctcgcaagtgagaggaggcagaagtacggagacggcatttacaggcactatcca
gagctcgactcagagtag

DBGET integrated database retrieval system