KEGG   Verticillium dahliae: VDAG_04207Help
Entry
VDAG_04207        CDS       T03450                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
vda  Verticillium dahliae
Pathway
vda00020  Citrate cycle (TCA cycle)
vda00190  Oxidative phosphorylation
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
vda01130  Biosynthesis of antibiotics
vda01200  Carbon metabolism
Module
vda_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vda_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vda_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VDAG_04207
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VDAG_04207
Enzymes [BR:vda01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VDAG_04207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 20705670
NCBI-ProteinID: XP_009648949
UniProt: G2X313
LinkDB All DBs
Position
1
AA seq 648 aa AA seqDB search
MASSMAMRRLAAAPSFSRASRLQTRAFSSTRPAARVFANGPLRAKEASPFVSNKYAVIDH
EYDAIVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWR
WHMYDTVKGSDWLGDQDAIHYMTREAPASIVELENYGCPFSRTEDGKIYQRAFGGQSQNY
GKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIMQDGECRGVLAYNQE
DGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGI
YGAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGAD
KDHIFLQLSHLPADVLHERLPGISETAGIFAGVDVTKQPIPVLPTVHYNMGGIPTKYTGE
VLTVDEAGNDKVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFTPGT
KLKPMEADAGAEHIEVLDQVRNSDGPRTTAQIRLSMQKAMQTEVSVFRTQESLDEGVRLM
KDIDAQFPEVGIKDRSMIWNSDLVETLELRNLLTCASQTAVSAANRKESRGAHAREDYPD
RDDENWMKHTLSFQKEPHGKVDLGYRRVIATTLDENECKAVPPFKRVY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctccatggcaatgaggagactggccgccgcgccctccttttcgcgcgcctcc
agacttcagacgagagccttctcctccacaaggcctgccgctcgggttttcgccaatggc
cctctgcgcgccaaggaggcatctcccttcgtgagcaacaagtacgccgtcattgaccac
gagtacgatgccatcgttgttggcgccggtggttccggtctgcgcgccgccttcggtctc
gccgaggctggcttcaacacagcctgtatctccaagctgttccctacccgaagccacacc
gtcgccgcccagggcggcatcaacgccgccctcggcaacatgcacgaggacgactggaga
tggcacatgtacgacaccgtcaagggctccgattggctcggtgaccaggatgctattcac
tacatgacgagggaagctcccgcgtccattgtcgagcttgaaaactacggctgccccttc
tcgcgtaccgaggatggcaagatctaccagcgtgctttcggtggtcagtcccagaactac
ggcaagggtggccaggcctaccgttgctgcgccgccgctgaccgaactggccacgccctt
ctgcacaccctgtacggccagtctctccgccacaacacgaactactttatcgagtacttc
gccctcgacctgatcatgcaggacggcgagtgccgcggtgtcctggcctacaaccaggag
gacggcactctgcaccgcttcctcgccaaccacaccgtcctcgccaccggtggatacggc
cgcgcctacttcagctgcacgtccgcccacacctgtaccggtgacggtatggccatggtt
gcccgtgccggtcttcccaaccaggatctcgagttcgtccagttccaccctaccggtatc
tacggagccggctgcctgatcaccgagggtgctcgtggtgagggtggttacctgctcaac
tcggagggtgagcgcttcatggagcgttatgctcccaccgccaaggatcttgcctcgcgt
gacgtcgtgtcccgctccatgaccatggagatccgtgacggccgtggtgtcggtgccgac
aaggaccatatcttcctgcagctcagccacttgcccgccgacgtcctgcacgagcgtctg
cccggtatttccgagacggccggtatcttcgccggtgtcgacgtcaccaagcagcccatc
cccgtcctgcccaccgtccactacaacatgggcggtatccccaccaagtacactggtgag
gtcctcaccgttgacgaggccggcaacgacaaggtcgtccctggcctgttcgcctgcggt
gaagctgcctgtgtgtcggtccacggcgccaaccgtctcggtgccaactcgctcctcgat
ctcgtcgtcttcggccgtgccgtctctcacaccattcgcgataacttcacacccggcacc
aagctcaagcccatggaggctgatgctggtgctgagcacatcgaggtcctcgaccaggtc
cgcaactcggacggtcctaggacaaccgcccagatccgtctctcgatgcagaaggcgatg
cagaccgaggtctccgtcttcaggacacaggagagcttggacgagggtgtccgcctcatg
aaggacattgacgcccagttccccgaggtcggcatcaaggaccgcagcatgatctggaac
tccgaccttgttgagactctcgagctgaggaaccttctgacttgcgcctcccaaaccgcc
gtttccgccgccaaccgcaaggagtcccgtggcgcccacgcccgcgaggactaccccgac
cgtgacgacgagaactggatgaagcacaccctgtccttccagaaggagccccacggcaag
gtcgacctcggctaccgccgcgtcatcgccacgacgctcgacgagaacgagtgcaaggcc
gtgccgccgttcaagcgtgtgtactaa

DBGET integrated database retrieval system