KEGG   Verticillium dahliae: VDAG_05667Help
Entry
VDAG_05667        CDS       T03450                                 

Definition
(RefSeq) repressible alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
vda  Verticillium dahliae
Pathway
vda00730  Thiamine metabolism
vda00790  Folate biosynthesis
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    VDAG_05667
   00790 Folate biosynthesis
    VDAG_05667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vda04147]
    VDAG_05667
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:vda00537]
    VDAG_05667
Enzymes [BR:vda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     VDAG_05667
Exosome [BR:vda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDAG_05667
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:vda00537]
 Enzymes
  VDAG_05667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 20707130
NCBI-ProteinID: XP_009653359
UniProt: G2X685
LinkDB All DBs
Position
4
AA seq 586 aa AA seqDB search
MAAQAAANDRTPLLDDTERRENINDDSESNSDNGHSPSSGGSNRLREVLLFVWALLATAA
VIVLAVWSQHNRQTGHGTGPTPEKRNLIFMVSDGMGPASLSLTRSFRQHVEGLPEDDTLT
LDKHFWGTSRTRSSNSLVTDSAAGATAFSCGKKSYNGAISITPEYEPCGTVLEAAKRAGY
ATGLVVTTDITDATPACFASHVLTRAMNDDIALQEVGDGPLGRVVDLMLGGGRCHFLPNG
TADSCRLDETDVVKIAQEQYNWTYASDRAGFDALKLGENVQLPALGLFAHYNVPFEIDRR
NLDHIYPSLTEMTHTALRALEKETEHSDHGFFLMIEGSRIDHAGHINDPAAQVHEVLQYD
AAFQAVLDFIEKSETETILVATSDHETGGLGTALQEPGHLPVYNWFPRALAKANASSEFL
SLQLAKHVAENPGEHKGKLRSWVNETLIYGGLGITDVHPEELDALVEAPLAAITTFAAII
SLRAHVGWSTHGHTAVDVNIYSSGGRDTEKIRGNVENTDVGKFLRDWLDLDVAPITEELK
SKLGKVNRNDLAAMDAVSGRPAEAAAAAGEVPQHWMEQHMRELAAI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcaagcagcagcaaacgaccgaacccccctcctcgacgacacggaacgtcgt
gagaacatcaacgatgactccgagtccaactccgataacggccactccccttcgtcaggc
ggatcgaaccgactgcgtgaggttctcctcttcgtctgggccctgttagcgaccgctgcc
gtgatcgtccttgcggtgtggagccagcataaccgccagacgggacatggaactggtccg
acgccagagaagcgaaacctcatcttcatggtctccgacggcatgggccctgcttccttg
tccctgacgcgaagcttccgccagcacgtcgagggtcttcccgaggatgacactctgacg
ctcgacaagcacttctggggcaccagccgcacgcgctcctccaactcgcttgttaccgac
agcgccgctggcgccacggccttttcgtgcggcaagaagagctacaacggcgccatctcc
atcacgcccgagtacgagccctgcggcaccgttctcgaggctgccaagagggccggctat
gcgacagggctggttgtgaccaccgacatcaccgacgccacgcctgcctgcttcgccagc
catgttctgacccgtgccatgaatgatgacattgccctgcaggaggttggcgatgggccc
cttggacgcgttgtcgacctgatgctcggcggtggccgctgccatttcctgcccaacggc
accgccgacagctgtcgcctggacgaaaccgatgtcgtcaagattgcacaagaacagtac
aactggacatacgcgagcgaccgagcgggattcgacgccctcaagcttggcgagaacgtt
cagctgccggcccttggcttgtttgcccactacaacgttccctttgagattgaccgccgc
aacctcgaccacatttaccccagcctgaccgagatgacccacactgcgctccgcgcgctg
gagaaagagacggagcacagcgaccacggcttcttcctcatgattgaaggcagcaggatt
gaccacgccggacacattaacgatcccgcggctcaggtccacgaagttctgcagtacgat
gctgccttccaggctgtgcttgactttatcgagaagagtgaaacggaaacaattctggtg
gccacgagcgatcacgagacgggtggtctcggcactgctctacaggagcctggacacctt
cctgtctacaactggttcccccgcgcccttgccaaggcgaatgcttcgtccgagttcctg
tccctgcagcttgccaagcacgttgccgagaacccgggcgagcacaagggaaagctgagg
agctgggtcaacgagacgctcatctacggcggtctcggcatcacagacgtgcaccctgaa
gagctcgacgctctcgttgaggcgcctcttgccgccatcaccaccttcgccgccatcatc
agcctgcgtgcgcacgtgggctggagcacgcacggacatacggccgtcgatgtcaacatt
tacagctcgggcgggcgcgacacggaaaaaatccgcgggaacgtcgagaacacggacgtt
ggcaagttcctgcgtgactggctcgacctcgacgtcgcacccattaccgaagagctcaag
tccaagctcggcaaggtgaacaggaacgacctcgcggccatggatgccgtttcgggtagg
cccgcagaggcggcggccgcggcgggcgaggtgccacagcattggatggaacagcatatg
cgcgagttggcggcgatctaa

DBGET integrated database retrieval system