KEGG   Verticillium dahliae: VDAG_05720Help
Entry
VDAG_05720        CDS       T03450                                 

Definition
(RefSeq) DNA ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
vda  Verticillium dahliae
Pathway
vda03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:vda00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    VDAG_05720
Enzymes [BR:vda01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VDAG_05720
DNA repair and recombination proteins [BR:vda03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     VDAG_05720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N RNA_ligase BRCT_2 DNA_ligase_A_C BRCT DNA_ligase_IV mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 20707183
NCBI-ProteinID: XP_009653412
UniProt: G2X6D8
LinkDB All DBs
Position
4
AA seq 1012 aa AA seqDB search
MKKLATILVLSSPKPIPKASPAVMSHQQGQPSPSAAAIEEDERQYAVGGMTLQEVNENYP
GRPRNHSETFLFSELFKSLFNPLMENKKQPPGSGPPRAKLGPHGPSKPSPSEQRRHIIDR
FISRWRKDVGNDFYPAMRLILPDKDRDRGVYGLKENAIGKLLVKLMKIDKNSEDGYNLLH
WKLPGQTTASRMAGDFAGRAFEVLSKRPMRIEVGDMTIADVNELLDKLAGSSGELENLEV
FETFYERMNAEELMWLIRIILKQMKVGATEKTLLHLWHPDAETLFNVSSSLRRVCWELFD
PQYRLEQENTGVTLMQCFQPQLAQFQMPASFQKMVDYLRPTEEDPEYWIEEKLDGERMQM
HMMEDASIPGGKRFCFWSRKAKDYTYLYGEGLKDDRGALTRHLGKAFAAGVRNIILDGEM
ITWDPETDKIMQFGTLKTAALAEQKNPYNNTGPRPLFRVFDILYLNDQPLTRYTLRDRYN
ALSKAVVGVHRRIEVHEHEAATSADAIEPLLRKVVAEASEGLVLKNPRSMYRLNSRNDDW
LKVKPEYMTEFGESLDCVVIGGYYGSGKRGGILSTYLCGLRVGENHIKAGANPEKCFSLF
KVGGGFSVEDYAEIRHHTDGKWKDWDPKKPPNEYIELAHGFAEKPDVWIRPKDSFVLEAK
ASSVGPSDQFALGFTLRFPRFRKLRKDKSWDQGLSVQEFQDLRRRVEEEAQEKTMSVENT
KRRAVKRVKKELVIAGTDSTPVQFEGEKSKVFEGLEFCVLSESLKPFKKTKTQLETMIKA
NGGRITQRHAARSDLILIADKRVVSVASLIKKGDVDIIRPNWVQDCLAQETDDGLLPYEE
RHLFHATEGLREIARQNTDEFGDSYFRIVDVEELRQILGDMPPHEESEGREEGAAEFARQ
LKERGNDLGERDSAIFDRCVVHLHVLPGGELDAFRLRNYIAFGGGEVTDGLPVDSSTHIV
LVGGQDAEKQDAAVSVRKDIGRRRKIPRVVDAQWVEDSWKERTMLDEERFGV
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcttgcgacgattctggtactgtcctctccaaagccgatacccaaagcctcg
cctgctgtgatgagccaccaacaagggcaaccgtcgcccagtgcggccgccatcgaagaa
gatgagcggcagtacgcagttggtggcatgaccttgcaagaggtcaatgagaactaccct
ggacgcccgaggaatcactccgagacattcctcttctcggagctcttcaaaagcctcttc
aaccctcttatggagaacaagaagcagcctccaggctctgggccgcctcgcgccaaactc
gggccccacggcccttccaagccgtcgccgagcgagcagcgccgccacatcatcgaccga
ttcatctcgcgatggcgaaaggatgtcggcaacgacttttacccggccatgcgattgatc
ctgcccgacaaggaccgcgacaggggcgtctatggtctcaaggagaacgccattggcaag
ctcctcgtcaagctcatgaagattgacaagaactccgaggacggctacaacctcctgcac
tggaagctgcccggccagaccacggcgtcgcgcatggccggcgactttgcgggccgagcc
tttgaggtcttgtcgaagcgtcccatgcgcatcgaagtgggtgacatgacgattgccgac
gtcaacgagctgctcgacaagctggccgggtcctcgggagagctggagaacctcgaagtg
tttgagacgttctacgagcgcatgaacgccgaagagctcatgtggctgatccgcatcatc
ctgaagcagatgaaggttggcgccacggaaaagacgttgcttcatctctggcaccccgac
gccgagactttgttcaacgtttcgtccagcttgcggcgcgtgtgctgggaactgttcgac
ccgcagtaccggctggagcaggagaacacgggcgtcacactcatgcaatgcttccagccg
caattggcccaatttcagatgccggcatcgttccagaaaatggtcgactacttgcggccc
accgaggaggatcccgagtactggatcgaggagaagctcgacggtgaacggatgcagatg
cacatgatggaggacgcctcaataccgggcggtaagcgcttctgcttttggtcgcgcaag
gccaaagactacacttatctctacggcgagggcctcaaggacgatcgcggcgcgctgacg
cgacacctcggcaaggcctttgccgctggcgtgcgaaacatcatcttggacggcgagatg
atcacctgggacccagaaaccgacaagatcatgcagtttggcaccttgaagacggcggcg
ctggccgaacagaagaatccctacaacaacactggcccccgcccgctcttccgcgtcttt
gacatcttgtacctgaatgaccagccgttgacgcggtacaccctccgcgatcgctacaat
gcgctgagcaaagctgtcgtcggtgttcacaggaggatagaggtacacgagcacgaggcc
gcgacatcggcggacgccatcgagccactccttcgcaaagtcgtcgccgaggcctcggaa
ggcttggtcctcaagaacccgcgctccatgtaccgcctcaacagccgaaacgacgattgg
ctcaaggtgaagcccgagtacatgacggagtttggcgaatcgctcgattgtgtcgtgatt
ggcggctactacggctcggggaagcgaggcggcattctctccacgtacctgtgcggcctg
cgcgtcggtgagaatcacatcaaagcgggagccaaccccgagaagtgcttcagtcttttc
aaggttggcggcggcttcagtgtggaggattatgccgagattcgtcatcacaccgacggc
aagtggaaggactgggatcccaagaagccgccgaacgagtacattgaattagcacacggc
tttgccgagaaaccagatgtctggatcaggccaaaggactcattcgtactcgaagcaaag
gcctccagcgttggaccatccgatcaatttgccttaggcttcacgctgcgattccccagg
ttccgcaagctccgaaaagacaagagctgggatcagggcctcagcgtgcaggaattccag
gacctgcgtcgccgtgtcgaagaggaggctcaggagaagacaatgagcgtggaaaacacg
aagcgcagagctgtcaagcgcgtcaagaaggaactcgtcattgccggcaccgacagcaca
cctgttcagtttgagggcgagaagtcaaaggtcttcgaggggctggaattctgcgtcctg
tctgagtccctcaagccattcaagaagaccaagacacagctagagacgatgatcaaagca
aacggcggtcgcatcacgcagcgacacgccgcgcggtcagacctgatcctgattgcggac
aagcgtgtcgtcagcgttgccagtctcatcaagaagggcgacgtggacatcatccggccc
aactgggttcaggattgtctcgcacaagagaccgacgacgggcttctgccgtacgaagaa
cgccatttgttccacgcgacagagggcttgcgagagattgctaggcagaacacggatgag
tttggtgacagctacttccggattgtagacgtggaagagctgcggcagattctgggcgac
atgcccccgcatgaggagagtgaggggcgcgaagagggcgcggcggagtttgcacgccag
ctcaaggagagggggaacgacttgggcgaacgtgacagtgccatctttgaccgttgtgtc
gttcacctccatgttctacccggcggcgagctcgacgcgtttcgcttgcggaactacatt
gcctttggcggcggggaggttacggatggtttgcccgttgattcgtccacgcacattgtg
cttgtcggagggcaagatgcagagaaacaagatgcggccgtttcggtccgcaaggatatc
ggcagacggcggaagataccccgcgttgtcgatgcacaatgggtagaggattcgtggaag
gagaggacgatgctcgatgaggagcgatttggggtataa

DBGET integrated database retrieval system