KEGG   Verticillium dahliae: VDAG_06181Help
Entry
VDAG_06181        CDS       T03450                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
vda  Verticillium dahliae
Pathway
vda00040  Pentose and glucuronate interconversions
vda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VDAG_06181
Enzymes [BR:vda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     VDAG_06181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox_2 PALP AdoHcyase_NAD Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 20707644
NCBI-ProteinID: XP_009657490
UniProt: G2X8P0
LinkDB All DBs
Position
8
AA seq 353 aa AA seqDB search
MSSNLSFVLNKVHDVSFEEREVPKITSEHDVLVAVNYTGICGSDVHYYDHGAIGHFVVKD
PMVLGHESAGTIVEVGSAVKTLVKGDRVALEPGYPCRRCADCLAGNYNLCHEMVFAATPP
YHGTLTGFWAAPADFCYKLPENVSLQEGALIEPLAVAVHITRQAAVTPGASVVVMGAGPV
GLLCAAVSRAFGATKVVSVDIVQSKLDMARDLASTHTYLSQRLPAEENAAALKAQCGLGK
GADVVIDASGAEPSIQTSLHTVRMGGTYVQGGMGKADINFPIMALCLKEVTAKGSFRYGP
GDYKLAIDLVANGSVNVKKLISEVVSFQEAEDAFKKVKQGQVIKVLIKGPNEQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaacctctccttcgtcctcaacaaggtccacgacgtctcctttgaggagcgc
gaggtgcccaagatcacgtcggaacacgacgtcctcgtcgccgtcaactacacgggcatc
tgtggctccgacgtccactactacgaccacggtgccattggccactttgtcgtcaaagac
cccatggtgctcggccacgagtctgccggtaccattgtcgaggttggctcggccgtcaag
acgctcgtcaagggcgaccgcgtggccctcgagcccggctacccgtgccgccgctgcgcc
gactgcctcgccggcaactacaacctctgccacgagatggtcttcgccgcgacgcccccc
taccacggcactctgaccggcttctgggccgctcccgccgacttttgctacaagctgccc
gagaacgtgtccctgcaggagggggccctcatcgagcccctcgccgtcgccgtccacatc
acacgccaggccgccgtcacgcccggcgcctccgtcgtcgtcatgggcgccggccctgtc
ggcctcctctgcgccgccgtctcgcgcgcctttggcgccaccaaggtcgtctcggtcgac
attgtccagtccaagctcgacatggcccgcgacctcgccagcacccacacctacctctcg
cagcgcctgccggccgaggagaacgccgcggccctcaaggcccagtgcggcctcggcaag
ggcgccgacgttgtcattgacgccagcggcgccgagcctagcatccagacgagcctgcac
acggtgcgcatgggcggcacctacgtccagggcggcatgggcaaggccgacatcaacttc
cccatcatggccctgtgcctcaaggaggtcaccgccaagggcagcttccgctacgggccc
ggcgactacaagctcgccatcgacctcgtcgccaacggcagcgtcaacgtcaagaagctc
atctccgaggtcgtgtccttccaggaggccgaggacgccttcaagaaggtcaagcagggc
caggtcatcaaggtcctcatcaagggccccaacgagcagtga

DBGET integrated database retrieval system