KEGG   Verticillium dahliae: VDAG_06289Help
Entry
VDAG_06289        CDS       T03450                                 

Definition
(RefSeq) membrane-bound O-acyltransferase domain-containing protein
  KO
K13519  lysophospholipid acyltransferase [EC:2.3.1.51 2.3.1.23 2.3.1.-]
Organism
vda  Verticillium dahliae
Pathway
vda00561  Glycerolipid metabolism
vda00564  Glycerophospholipid metabolism
vda00565  Ether lipid metabolism
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
Module
vda_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    VDAG_06289
   00564 Glycerophospholipid metabolism
    VDAG_06289
   00565 Ether lipid metabolism
    VDAG_06289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vda01004]
    VDAG_06289
Enzymes [BR:vda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     VDAG_06289
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     VDAG_06289
    2.3.1.-  
     VDAG_06289
Lipid biosynthesis proteins [BR:vda01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   VDAG_06289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT PAP2
Motif
Other DBs
NCBI-GeneID: 20707752
NCBI-ProteinID: XP_009656962
UniProt: G2X731
LinkDB All DBs
Position
8
AA seq 543 aa AA seqDB search
MLPLINKPFELLSPGLGVPTDDIKLVFSWLLSYPLAALLKCIPDSRPDLKNIYVISASIF
YLVGLFNLWAGLQTLFISSAGTYLIANTFRHSPFMPWIGFVFVMGHLSINQISRQLESNP
ADVDITGAQMVLVMKLSAFCWNVADGQLPSDHLSDFQKDRKLVELPPLLEYAGYVMFFPS
LFGGPTFEYVEYRRWLDTSMFDLPPNLEASKKPPVRRQRKVPRSGTPAAWKAASGLMWIA
FFVFMSGSFSPSRLTHPALLEHGFIRRVWILYCVGLTARMKYYGAWSLAEGACILTGLGY
NGVDPITGRVSWNRLQNIDPRGVELAQNVRGYLGSWNMNTNKWLRNYVYLRVTPRGKKPG
FRASLMTFGTSALWHGFYPGYYMTFILASLIQTVAKNFRRYVRPFFLDPDSGLPNRKKKY
YDVLSFLTTQVVMSFAVAPFLILSFSGSVLVWSRVYFFAIVGVAVSMGFFASPGKQILKQ
GLESRQRRPGIQLGRTLSSDSLVGREPVLGVAADPERELDEAVQEIRAEVEARHRVKTRH
HKA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccctaataaacaagcccttcgagctcctgtccccaggacttggcgtgcctaca
gacgacatcaagctcgtgttttcatggctactctcgtatccactggctgctcttctcaag
tgcattcctgattctcgacctgaccttaagaatatttacgtgataagcgcgtcgatattc
tatcttgttggcctcttcaatctctgggctggtttgcaaactcttttcattagttccgct
gggacatatctcattgccaatacgtttcgccacagtcctttcatgccatggatcggcttt
gtcttcgtgatggggcacttgtccatcaaccagatcagtcgacagctagaaagtaatccg
gccgacgtcgacattactggtgcgcagatggtactggtcatgaagctcagcgcgttctgc
tggaacgtggcagatggtcagcttcctagcgaccacttgtccgattttcagaaggatagg
aagctggtagagcttccacccctgctggagtacgccggttatgtcatgtttttcccttca
ctctttggtggtcctacgttcgaatacgtcgagtatcgccggtggctggacacttccatg
tttgatctaccgcccaatctggaagcttcaaaaaagccaccggtgagaaggcaacgcaaa
gtccctcgcagtggaactccagcggcgtggaaagcagcatctggtctcatgtggattgct
ttcttcgtattcatgtccggttccttcagcccttcaaggctaactcacccggccttgctt
gagcacggcttcatccgccgcgtgtggatcttatactgcgtcgggttgaccgcaaggatg
aagtactatggagcatggtccctggctgaaggtgcatgcatcctcactgggctcggatac
aatggtgtcgaccccatcaccggcagagtctcgtggaacaggctacagaacattgacccc
agaggcgtcgagttggcccagaatgtacgcgggtacctcggcagctggaatatgaatacc
aacaagtggctccggaactatgtatacctccgtgttacaccccgagggaagaagcccgga
ttccgagctagtctcatgacatttggaaccagtgcgctttggcacggcttctatcccggc
tattatatgacatttattctggcaagcctcatccaaaccgtggccaaaaactttcgccgc
tacgtccgccctttcttcctcgacccagactccggtctgccgaaccgcaagaagaagtat
tacgacgtgctatcttttctcactacgcaggtggtgatgtcatttgccgttgctcctttc
ctcattcttagcttttccggatccgtcttggtctggtcgcgagtttacttctttgccatc
gtgggcgtggccgtctcgatgggcttcttcgcgtctccggggaagcagatcttgaagcaa
gggttagaaagtcgccagcggcggccaggcatccagcttggccgtaccttaagctccgat
agcctcgttgggcgcgaaccagtcctcggtgtggcggcggatccagaaagggagttggat
gaggcagtccaagagatcagagctgaggtggaggctcgtcaccgagtgaaaaccaggcac
cacaaagcataa

DBGET integrated database retrieval system