KEGG   Verticillium dahliae: VDAG_07671Help
Entry
VDAG_07671        CDS       T03450                                 

Definition
(RefSeq) glutathione transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vda  Verticillium dahliae
Pathway
vda00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VDAG_07671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vda02000]
    VDAG_07671
Enzymes [BR:vda01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VDAG_07671
Transporters [BR:vda02000]
 Other Transporters
  Pores ion channels [TC:1]
   VDAG_07671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_C_5 GST_C_3 GST_N GST_C
Motif
Other DBs
NCBI-GeneID: 20709134
NCBI-ProteinID: XP_009654871
UniProt: G2XBN5
LinkDB All DBs
Position
5
AA seq 286 aa AA seqDB search
MSNVDLSIPTHTTGAAADFAAKHASNHDLAFYGGWFCPFVQRSWMVLHEKRIEHHYKEVN
PYNKDPDGPNKEFLSLNPRGLIPTMAVPARDEDGKVRPLYDSTIVSEYLDEEYADESKHG
PRLFPKDPYERARCRLWIDHINNKIVPGFYKFIQHTPEKTYPIDDARSEFLNHIETLVRE
MQSSGPWFLGERFSMVDVMLAPWAMRLFLIDHYKPGGVGIPPMTKESGESGTWSRWKTWF
DAISERQSVKDTLSAREAYVASYKRYAEDTTNSLVAQATRSGGRMP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgttgacctctccattccaacccatactaccggcgccgctgcggatttcgcc
gcgaagcacgcaagcaaccatgacctggccttctacggcggctggttttgcccctttgtc
cagcgctcttggatggttctgcacgagaagcggattgagcatcactacaaggaggtgaat
ccctacaacaaggaccccgatggtcccaacaaagagtttctcagtttgaatccgcgcggc
ctgatccccaccatggctgttccagcacgagacgaggacgggaaggtccgtcccttgtac
gacagcaccatcgtctccgagtacctcgacgaggagtatgcagacgagtcaaagcatggc
cctcgactcttccctaaggatccatacgaacgcgcaaggtgcaggctctggatcgaccac
atcaacaacaagattgtcccaggcttttacaagtttatccagcacacgcccgaaaagacc
tacccaatcgacgacgcgcgatctgagtttctgaaccatatcgagaccctagttcgtgag
atgcaatctagcgggccgtggttccttggcgagcgcttctccatggttgatgtgatgctt
gcgccgtgggctatgcgactgtttttgatcgaccactacaagcctggcggcgtgggcatt
cctccgatgacgaaggaaagcggcgagtccgggacctggtcccggtggaagacgtggttc
gatgctatcagcgagcgacagagcgtgaaagacacactgagtgctcgggaggcctatgtt
gcgtcctacaagcggtacgcagaagacactaccaattccttggtggcgcaggctactagg
agtgggggacggatgccatga

DBGET integrated database retrieval system