KEGG   Verticillium dahliae: VDAG_10018Help
Entry
VDAG_10018        CDS       T03450                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
vda  Verticillium dahliae
Pathway
vda00020  Citrate cycle (TCA cycle)
vda00310  Lysine degradation
vda00380  Tryptophan metabolism
vda01100  Metabolic pathways
vda01110  Biosynthesis of secondary metabolites
vda01130  Biosynthesis of antibiotics
vda01200  Carbon metabolism
Module
vda_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vda_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VDAG_10018
  09105 Amino acid metabolism
   00310 Lysine degradation
    VDAG_10018
   00380 Tryptophan metabolism
    VDAG_10018
Enzymes [BR:vda01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     VDAG_10018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N YceG_bac BioY
Motif
Other DBs
NCBI-GeneID: 20711481
NCBI-ProteinID: XP_009654070
UniProt: G2XIN6
LinkDB All DBs
Position
4
AA seq 1047 aa AA seqDB search
MLRSSLSKASTRVLQSSRCAAPSSRRFSTLPTTPRTAATQTLAASRRPLSLTARRHYASA
TDNAPDPNDNFLSGNTANYIDEMYMQWKEDPKSVHVSWQVYFRNMESGDMPISQAFTPPP
SLVPGATGGVPRLAAGSAEGTEVANHLKVQLLVRAYQARGHNKANIDPLGIRNEQKGFGN
IKPKELTLEHYQFTEKDLDTEYSLGPGILPRFKREGREKMTLREIIDACERIYCGSYGIE
FIHIPDREKCDWLRERLEVPQPFKYSIDEKRRILDRLIWSSSFESFLSTKYPNDKRFGLE
GCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAGAED
EGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKAHR
TAMGVLLHGDAAFAAQGVVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAYC
TDIAKAIDAPVFHVNADDVEAVNFVCQMAADWRAEFQQDVIVDLVCYRKHGHNETDQPSF
TQPLMYKRIQSHKSQIAIYVDKLIKDGTFTKEDVEEHKQWVWGMLEESFTKSKEYQPTSK
EWTTSAWNGFKSPKELATEVLPHNTTSVDKKTLEHIGEVIGSTSEGFNVHRNLKRILSNR
TKSVVEGKNIDFPTAEALAFGSLVTEGHHVRVSGQDVERGTFSERHAVFHDQETEDTYTP
LQNISKDQGKFVIANSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQFI
ASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRVFPSPEKLERQHQDC
NMQIAYFTTPANLFHALRRQMHRQFRKPLIIFFSKSLLRHPLARSNIEEFVDESHFQWII
PDPEHEAGTIKKPEEIKRVVLCTGQVWAALHKYRADNKIDDTAFTRIEQLNPFPWQQLKE
NLDQYPNAETIVWAQEEPLNAGAWSFTQPRIETLLNQTEHHNRKHVMYAGRNPSASVAAG
TKGLHTKEEQEFLEMAFTVKQDKLKGE
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcagctcgctgagcaaagccagcactcgggtgcttcagagctcccggtgcgcg
gccccttcatcccgtcgcttctcgaccctccctaccacgccgcgtaccgccgcgacacag
actctggccgcaagccgccgacccttgagcttgaccgcgaggaggcattacgccagcgcc
accgacaatgctcccgatcccaatgataacttcctctccggaaacaccgccaactacatt
gacgagatgtacatgcagtggaaggaggatcccaagagcgtccacgtctcatggcaggtc
tacttccgcaacatggagtctggcgacatgcccatctcccaggccttcaccccgccgcct
tctctcgtgcccggcgccacgggaggcgtccctcgcctcgccgccggcagcgctgagggc
accgaggtggcgaaccacctgaaggtccagctcctcgtccgcgcctaccaggctcgcggc
cacaacaaggccaacatcgatcccctcggtattcgcaacgagcagaagggctttggtaac
atcaagcccaaggagctcaccctcgagcactaccagttcaccgaaaaggacctcgacacc
gaatactcccttggccccggcatcctgcctcgcttcaagcgtgagggccgcgagaagatg
acgctgcgcgagatcattgacgcctgcgagcgcatctactgcggatcctatggaattgag
ttcatccacattcctgatcgtgagaagtgcgactggctgcgcgagcgcctcgaggtgccc
cagcccttcaagtacagcattgacgagaagcgccgcatcctcgaccgccttatctggagt
tcgagcttcgagtccttcctgtccacaaagtaccccaacgacaagcgtttcggcctcgag
ggttgcgagaccctggtccccggtatgaaggctctgatcgatcgcagtgtcgactacggc
gtcaaggacattgtcattggcatgccgcaccgtggccgtctcaacgttctcagcaacgtc
gtcaggaaacccaacgagtccatcttctccgagttcgctggtactgccggtgccgaggat
gagggatctggcgatgtcaagtaccatcttggcatgaactttgagcgccccaccccctcg
ggcaagcgtgtccagctgtcccttgtggccaacccttcccatctcgaggccgaggacccc
gtcgttctcggtaagacgcgcgccatccagcactacaacaacgacgaaaaggcccaccgc
actgccatgggcgtcctgctccacggtgacgccgctttcgccgcccagggtgtcgtctac
gagtgcctcggcttccactcgctccctgccttctctactggtggcaccatccacctcgtc
gtgaacaaccagatcggcttcaccaccgacccccgtttcgctcgctcgaccgcctactgt
accgatatcgccaaggctatcgacgcccccgtcttccacgtcaatgccgacgacgtcgag
gccgtcaacttcgtctgccagatggctgccgattggcgtgccgagttccagcaggatgtc
atcgtcgacctggtctgctaccgcaagcacggccacaacgagactgaccagccttccttc
acgcagcccctgatgtacaagcgcatccagtcgcacaagtctcagattgccatctacgtc
gacaaactcatcaaggacggcaccttcaccaaggaagacgtcgaagagcacaagcagtgg
gtctggggtatgctcgaggagagcttcaccaagtccaaggaataccagcccacctccaag
gagtggacgacttcggcctggaacggcttcaagtcgcccaaggagctggccaccgaggtt
ctgccgcacaacacgaccagcgtcgacaagaagactctcgagcacattggtgaggttatt
ggcagcacaagtgagggcttcaacgtgcacaggaacctcaagcgtatcctctccaacagg
accaagtctgtggttgagggcaagaacattgacttccccacggccgaggctctcgccttt
ggttccctcgtcaccgagggccaccacgtccgcgtgtccggtcaggatgtcgagcgtggg
accttctcggagcgtcacgccgtcttccacgaccaggagactgaggacacctacacacct
ctgcagaacatcagcaaggaccagggcaagttcgtcattgccaactcgtctctgagtgag
tttggtgcccttggcttcgaatacggttactctctctcgtctcccaacgcgctcgtcatg
tgggaggcccagttcggtgacttcgccaacaacgcgcagtgcatcattgaccagttcatc
gcttccggtgaggtcaagtggatgcagaggacaggcctcgtcatgtcgctgccccacggt
tacgacggtcagggtcccgagcactcctctggacgcttggagcgttacctgcagctctgc
aacgaggaccctcgtgtcttcccctcgcccgagaagctcgagcgccagcaccaggactgc
aacatgcagatcgcttacttcacgacccctgccaacttgttccacgcccttcgtcgccag
atgcacaggcaattccgcaagcccctcatcatcttcttctccaagtcgctcctccgccac
cctctggcgcggtccaacatcgaggagtttgttgacgagtcccacttccagtggattatc
cccgaccccgagcacgaggccggcaccatcaagaagcccgaggagatcaagcgtgttgtg
ctctgcacgggtcaggtgtgggctgcgctgcataagtaccgcgcggacaacaagatcgac
gacacggcgttcacgcgtattgagcagctcaaccccttcccgtggcagcagctcaaggag
aaccttgaccagtaccccaacgcagagacgattgtctgggcccaggaagagccgctcaac
gctggtgcgtggagcttcacgcagcctcgcatcgagacgctcctcaaccagaccgagcac
cacaaccgcaagcacgtcatgtacgctggccgcaaccccagcgcgtccgtggcagcgggt
accaagggcctgcacaccaaggaagagcaagagttcctggagatggccttcactgtcaag
caggacaagctgaagggcgagtaa

DBGET integrated database retrieval system