KEGG   Vibrio diabolicus: AL552_01105Help
Entry
AL552_01105       CDS       T05332                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vdb  Vibrio diabolicus
Pathway
vdb00500  Starch and sucrose metabolism
vdb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vdb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL552_01105
Enzymes [BR:vdb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL552_01105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AVF92466
LinkDB All DBs
Position
2:complement(233098..234447)
Genome map
AA seq 449 aa AA seqDB search
MSGSQEIQSFGANVILHAFDWKYADIAQRAKEIHELGYGSVLISPPMKSAHDDRWWQRYQ
PQDYRVIDNALGDTKDFIRMVRELEQVGVWVYADVVFNHMANEAHLRRDLQYPRQEVLEK
YQQNKQKYQSLTLFGDLSQPLFDEEDFVEAFGIKDWKDKWQVQNGRITGGPTDPGLPTLR
VCDHVVEQQRAYLKALKAIGVKGFRIDAAKHMTLEHLKRVWTDDITRDVHIFGEIITDGG
ATEEEYQLFLEPYLQETRLGAYDFPLFSTIFKAFAKKGSFKSLIDPYCFGQALSPGRAIT
FVVTHDIPNNDVFLDLIMDEENEWLAYAYILGRDGGVPLVYTDLNTSGITDKNGKPRWQG
AWNDPRMAKMIQFHNMTHGESMSVLEGNDDMLVFKRGSKGIVVLNKSQRQQSLALKMDGD
WVDLMTDQDVPSDGKLIVPPKASMLLVEN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctcacaggaaatacaatcattcggtgcgaatgttatcttacatgcgtttgat
tggaagtatgctgacattgcccaacgagcaaaagaaatccacgagctaggttacggctcc
gtgttgatttcgccaccaatgaaaagcgcccacgatgatcgctggtggcagcgctatcaa
cctcaagattaccgtgtcatcgacaatgcgttgggtgataccaaagactttatccgtatg
gttcgtgaactggagcaagttggcgtgtgggtttacgctgacgtggtgtttaaccatatg
gcaaatgaggcccaccttcgccgagacctccaatacccaaggcaagaggtcctggagaaa
taccaacaaaacaaacagaaatatcagtcgctaacgttatttggcgacttatctcaaccg
ctttttgatgaagaggactttgttgaagcgttcggtattaaagactggaaagataaatgg
caggtacaaaatggacgcatcacaggtggaccaaccgatcctggcttgccaaccctccgt
gtttgtgaccatgtcgttgagcagcaacgcgcttacctaaaagcactgaaagccattggt
gtgaaaggttttcgtattgatgccgcgaaacacatgacgttagagcatcttaaacgtgtt
tggacagacgacatcacgcgcgatgtgcatatatttggcgaaattattaccgatggcggt
gcgacggaagaagagtatcagttgtttcttgagccgtatttacaggaaactcgcttaggc
gcttacgatttcccgttgttctcgaccatttttaaggcgtttgctaaaaagggcagtttc
aagtcgttgattgacccatactgtttcggtcaggccctttcgcctggtcgcgccattaca
tttgttgtcacgcatgacattcctaacaatgacgtttttcttgatctgatcatggatgag
gaaaacgaatggttagcttatgcctacattctaggccgcgatggtggtgtgccattggtt
tataccgacttaaacacgagcggtattacagataaaaatggcaaaccaagatggcaaggc
gcatggaacgatccgcgaatggcgaaaatgatccagttccataatatgacgcatggcgag
tcgatgagtgttcttgaaggtaacgatgatatgctggtatttaagcgagggagcaaaggc
attgtcgtgcttaataaatcgcagcgtcagcagtctttggcattgaaaatggatggcgac
tgggtggatttgatgacggatcaggacgttccatctgacggtaagttaattgtgccacct
aaagcctcaatgttgctcgtcgaaaactaa

DBGET integrated database retrieval system