KEGG   Vibrio diabolicus: AL552_03935Help
Entry
AL552_03935       CDS       T05332                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vdb  Vibrio diabolicus
Pathway
vdb00550  Peptidoglycan biosynthesis
vdb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vdb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL552_03935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vdb01002]
    AL552_03935
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vdb01011]
    AL552_03935
Enzymes [BR:vdb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AL552_03935
Peptidases and inhibitors [BR:vdb01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AL552_03935
Peptidoglycan biosynthesis and degradation proteins [BR:vdb01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AL552_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AVF92986
LinkDB All DBs
Position
2:833625..834782
Genome map
AA seq 385 aa AA seqDB search
MKVSLARWTIVTCLISVPTFAVVTPNPPQLQAKGYVLMDFQSGAIIAEHNGRAGLAPASL
TKLMTAYVVGQEIKAGRLNWDDVVTVSENAWSAKFPGSSKMFIKPKDEISVANLMRGVII
QSGNDACVALAEHVAGSERGFVALMNGWAEKLGLQDTYFVNSHGLDSDGIQTSPTDMAKL
MQSIISDVPDVYALYSEKVFKWNDITQYNRNKLLWDNSIDVDGGKTGYTSNAGYSLVSSA
KEGRMRLISVVMGTPSKQARISQSKNLLSYGFRFYDTKQVAKQGEVESKVRVWKGNANQV
EAIFAKDAYLTLPRSMTAGLDKSVVLNEPLIAPIAQGDEIGKVVWKSDDSTVASYPLVSS
QAVEEGSWFGQLWDSLVLWVKSFFN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtcactggctcgatggacaattgtgacttgtttaataagcgtacctactttt
gccgttgttacgcctaacccacctcagttacaggcaaaaggctacgtattaatggacttt
caatccggtgccattattgccgagcataacgggcgagcaggccttgctccggcgagttta
accaagttgatgaccgcttatgtagttggacaagaaatcaaagcggggcgtttgaattgg
gatgatgttgtcaccgtgagcgaaaacgcgtggtcggccaagtttcccggttcttctaaa
atgttcatcaaaccgaaagatgaaattagtgttgcgaacttaatgcgcggcgtgatcatc
caatcaggaaatgacgcgtgcgttgcactggctgagcacgttgcaggtagtgaacgcggc
tttgtcgccttgatgaatggttgggcggagaaattaggacttcaagacacctattttgtg
aactctcatggtcttgatagtgatggcatccaaacctcaccaaccgatatggcaaaactc
atgcagtcgatcatcagcgatgttcctgatgtgtatgcgctatacagcgagaaagtcttc
aagtggaacgacattacgcagtacaaccgcaataagttgttgtgggacaattccattgat
gtcgacgggggcaaaaccggctacaccagcaatgccggatacagcttggtgagctcggcc
aaagaaggaagaatgcgccttatttcggtggtgatgggcacgccaagtaaacaggctcgg
atcagccaatcgaagaatctactcagctatggttttcgcttttatgacaccaagcaagtt
gctaaacagggagaagttgagtctaaagttcgcgtttggaaggggaatgctaatcaagtt
gaagcgatcttcgctaaagatgcctatctcactctacctcgttcaatgacggctgggctt
gataagagtgtggtgttaaatgaaccgttgattgcgccgatcgcgcaaggagatgagatt
ggtaaggtcgtttggaaaagcgatgacagtaccgtggcgagttatcccttggtcagcagc
caagcggtagaagagggctcgtggttcggtcagctttgggacagtctggtgctgtgggtg
aaatcgttctttaactag

DBGET integrated database retrieval system