KEGG   Vibrio diabolicus: AL552_13025Help
Entry
AL552_13025       CDS       T05332                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vdb  Vibrio diabolicus
Pathway
vdb00220  Arginine biosynthesis
vdb00250  Alanine, aspartate and glutamate metabolism
vdb00290  Valine, leucine and isoleucine biosynthesis
vdb01100  Metabolic pathways
vdb01110  Biosynthesis of secondary metabolites
vdb01130  Biosynthesis of antibiotics
vdb01210  2-Oxocarboxylic acid metabolism
vdb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vdb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL552_13025
   00290 Valine, leucine and isoleucine biosynthesis
    AL552_13025
   00220 Arginine biosynthesis
    AL552_13025
Enzymes [BR:vdb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     AL552_13025
    2.6.1.66  valine---pyruvate transaminase
     AL552_13025
Amino acid related enzymes [BR:vdb01007]
 Aminotransferase (transaminase)
  Class I
   AL552_13025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AVF94646
LinkDB All DBs
Position
1:complement(838517..839731)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLIPAPDYPLWTASVALSGGKPVHYLCDEGADWYPDLEDIKKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHKLIIFADEIYDKVLYDGATHTSVATLTEDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYVNGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAYELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLEIAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctacgacattaggggtcct
gtactcaaacatgctaagcgcatggaggaagaagggcataaaatcctaaagctaaacatt
ggtaaccctgccccatttggttttgacgcccctgatgagattttagtcgacgtgattcgt
aatctgccgacttctcaaggctattgtgattccaaaggcatttactctgctcgtaaagcc
gtggtccaacactatcaacgtaaaggtatccgctcgctagatgtcgaagatgtgtatgtg
ggtaacggcgtgtctgagctgatcgtgatggccatgcaagcgctattaaacaatggcgac
gaaatgctgatcccagcacctgattacccgttgtggacagcttcagttgcactatcaggc
ggtaagccggttcattacctatgtgatgaaggtgcagactggtacccggaccttgaagac
atcaaaaagaaaatcacaccgaagacacgtggcattgttctgatcaacccgaacaacccg
acaggtgcggtatacagccgtgacttcctacttgaagtgattgaaatcgcgcgccagcac
aaactgatcattttcgcagatgagatctacgacaaagtgttgtacgacggtgcaacacat
acctcagtcgcaacactcactgaagacgtgctagtcatgacattcaatggcctttcaaaa
gcctaccgtgtttgcggtttccgtggtggctggatgttcctaacggggcctaaacatcta
gctcaagggtacgtgaatggattggagttgctttcatcgatgcgtttatgtgcaaacgta
ccaatgcaacatgcgattcaaactgcgctaggtggataccagagtatcaatgaactgatt
ttacctggcggacgcttattagagcagcgcaatagagcgtatgaactgatcaatcagatt
cctggtgtttcttgtgtcaaacctaagggtgcgatgtacctcttcccgaaaatcgacaca
aaaatgtacaacatcaagaacgatcagcagatggttttagatttcttaaaacaagagaag
gtcttactggtgcaaggttccggcttcaactggccgaaaccagaccatttccgcatcgtg
acactgccgcacgttgaagatctagaaatcgccattggacgttttgagcgattcctatca
acctacagccagtaa

DBGET integrated database retrieval system