KEGG   Vibrio diabolicus: AL552_13385Help
Entry
AL552_13385       CDS       T05332                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter ATP-binding protein HisP
  KO
K10025  arginine/ornithine transport system ATP-binding protein [EC:7.4.2.1]
Organism
vdb  Vibrio diabolicus
Pathway
vdb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vdb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AL552_13385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vdb02000]
    AL552_13385
Enzymes [BR:vdb01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     AL552_13385
Transporters [BR:vdb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Arginine/ornithine transporter
    AL552_13385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_13 Mg_chelatase AAA_23 G-alpha PRK AAA_25 AAA_16 RsgA_GTPase Rad17 AAA_15 FtsK_SpoIIIE AAA_22 AAA_33
Motif
Other DBs
NCBI-ProteinID: AVF94708
UniProt: A0A2L2K363
LinkDB All DBs
Position
1:916483..917253
Genome map
AA seq 256 aa AA seqDB search
MNDVPALDIKDLHKTFGQNEVLKGISLAAHKGDVISIIGSSGSGKSTFLRCINLLETPTA
GEIWVNGELIQMKNNRAGESVPANEKQVQRIRSRLAMVFQGFNLWSHLTVLENVIEAPVH
VLGVPKAQAIENAEVLLKKVGLYERKDYYPGHLSGGQQQRAAIARALAVDPEVMLFDEPT
SALDPELVGEVLGVMRDLADEGRTMLVVTHEMAFARDVSNHVMFLHQGLVEEQGNPAKLF
TNPDSERLQQFISSIY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatgtaccagcgctagatataaaagacctgcacaaaacatttggacaaaatgaa
gttctcaagggaatttctcttgccgcgcacaaaggagatgtcatctccatcattggctct
tccggttctggtaagagtacctttcttcgatgtatcaacttgctagaaacgcctaccgca
ggtgaaatttgggtgaatggtgaattaatccaaatgaagaacaaccgagcaggggaatcc
gttcctgctaatgaaaagcaagtgcaacgtattcgctcacgtctagcgatggtgttccaa
ggtttcaacttatggtcacacctgacagtactagaaaacgtgattgaagcccctgttcat
gttctaggcgtaccaaaagcccaagcgattgaaaacgcagaagtcttgcttaagaaagta
ggcctatatgagcgtaaagactattatcctgggcacttatctggcggtcagcaacaacgt
gccgctattgcccgtgcgctagcagttgaccctgaagtgatgttgtttgacgagccaacc
tcggcgcttgacccagaacttgttggggaagtattaggggtaatgagagatttggcagat
gaaggacgaaccatgctggtggtcacgcacgaaatggcgtttgcgcgagacgtatcaaac
catgtgatgttcttgcatcaaggcttagtggaagaacagggaaatccagctaagctattt
acaaacccggattcggaacgattacagcagtttatctcatccatttactaa

DBGET integrated database retrieval system