KEGG   Vibrio diabolicus: AL552_14430Help
Entry
AL552_14430       CDS       T05332                                 

Gene name
panP
Definition
(GenBank) putative pyridoxal-dependent aspartate 1-decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vdb  Vibrio diabolicus
Pathway
vdb00250  Alanine, aspartate and glutamate metabolism
vdb00410  beta-Alanine metabolism
vdb00430  Taurine and hypotaurine metabolism
vdb00650  Butanoate metabolism
vdb01100  Metabolic pathways
vdb01110  Biosynthesis of secondary metabolites
vdb01120  Microbial metabolism in diverse environments
vdb02024  Quorum sensing
Module
vdb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vdb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AL552_14430 (panP)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AL552_14430 (panP)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AL552_14430 (panP)
   00430 Taurine and hypotaurine metabolism
    AL552_14430 (panP)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AL552_14430 (panP)
Enzymes [BR:vdb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AL552_14430 (panP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HSCB_C FAD-SLDH Aminotran_1_2 AAA_33 DUF5446
Motif
Other DBs
NCBI-ProteinID: AVF94902
LinkDB All DBs
Position
1:complement(1143900..1145546)
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSSPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQSDTFYDQWMHSANHSLGAFCSGGTIANITA
LWVARNKALRANGSFKGVEKEGLFKAMKHYGYDGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKAKIVELEKQNIKPIAVIGVAGTTETGNVDPLPEIAEVCQAHG
CHFHVDAAWGGATLMSNHHRHLLNGVEMADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPFIREALAKAEGSQKEQLNELINELTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTKEILSSVLDEQREIAKQAPNLMERIQQ
VVTDIQSS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttgctaaagatcttcact
gtcccagaaggtcctgactcaacgttaaccaaaattgacgagagcctctcgcgaaatcta
aatcaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgcgaaatcgaaaaa
gacttttcttctgctcagattcctgagcagccagagttcgtgtcagatcatacagaacac
ttactcgacactttggtgtcgcactccgttcacacttcttcaccaagcttcattggtcat
atgacatcggcgctgccttatttcttgatgccactgtcaaagatcatgatcgccttaaac
caaaacctagtaaagatagagacttctaaagcctttaccccgcttgaacgtcaagttttg
ggcatgctacatcgcttgatctatggtcagagcgatacgttttacgatcagtggatgcat
agcgcaaaccactcattgggcgcattttgctccggcggtaccattgccaatatcactgca
ctttgggtagcacgtaacaaggcgttaagagccaatggttcatttaaaggcgttgagaaa
gaaggcctatttaaagccatgaagcattatggctacgatggcttagcggtattggtgtct
gagcgtggtcactactcccttaagaaagcagccgatgtactaggtttaggtcaagaaggc
ttggttgcggttaaaacggatgccaacaaccgtattattgtcgacgaccttaaagcgaaa
attgttgaactagagaaacaaaacatcaagcctattgctgttattggtgtagctggtaca
acagagacaggtaatgtcgacccgctacctgaaatcgcagaagtctgtcaagctcacggt
tgtcatttccatgtggatgccgcatggggtggcgcaacacttatgtctaatcaccatcgt
caccttcttaacggtgtggaaatggcagactcagtaaccattgatgcgcacaagcaactc
tacatcccgatgggcgctggtatggttctgttcaaagaccctgacgcaatgaaatccata
gagcatcacgctcaatatatcttgcgtaaaggctcaaaagacctaggcagtcatacatta
gaaggctctcgttcaggcatggcaatgttggtctatgccgcaatgcacatcatcagccgc
cctggctatgagctgctgatagaccaaagcattgaaaaagctcgctactttgcggattta
atcaagcagcaagatgatttcgaattggtttctgaaccagagctttgtctgctcacatac
cgctacttgccgccattcatccgtgaggcattagcaaaagcggaaggttcacaaaaagaa
caactgaatgaactgattaatgaattaacacagtttattcaaaagcgtcagcgtgaaacg
ggcaaatcgtttgtttcacgtacaagactgaacccagaccaatggcagcgcatgaacacg
attgtgttccgagtggttttagcaaatccgctgacgaccaaagaaattttgagttcggtg
cttgatgaacagcgtgaaatcgccaagcaagcaccaaatttgatggaaagaattcagcag
gtggtcactgatatccaatcgtcttaa

DBGET integrated database retrieval system