KEGG   Vibrio diabolicus: AL552_19230
Entry
AL552_19230       CDS       T05332                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vdb  Vibrio diabolicus
Brite
Enzymes [BR:vdb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AL552_19230
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: AVF95706
LinkDB
Position
1:2042105..2042689
AA seq 194 aa
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDSAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcactagaaccacacatctca
gcagagactctagactaccaccacggtaagcaccacaacacctacgttgttaagcttaac
ggtcttatccctggtactgagttcgaaggcaaaactctagaagagatcatcaagacttct
actggtggcgtattcaacaacgcagcgcaaatctggaaccacacgttctactggcactgt
cttgctccaaacgcgggcggcgaaccaacaggcgcagttgctgacgcaatcaacgcagca
ttcggttctttcgaagaattcaaagcgaagtttactgattcagcaatcaacaacttcggt
tcttcatggacttggcttgttaagaaagctgacggctctctagagatcgttaacacttct
aacgctgctactcctctaacagaagaaggcacaacaccacttctaactgttgacctatgg
gaacacgcatactacatcgattaccgcaacgtgcgtcctgattacatgaacggcttctgg
gcacttgtaaactgggactttgtagctgagaacctagcgaagtaa

DBGET integrated database retrieval system