KEGG   Vulcanisaeta distributa: Vdis_0679Help
Entry
Vdis_0679         CDS       T01313                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi00620  Pyruvate metabolism
vdi00680  Methane metabolism
vdi00720  Carbon fixation pathways in prokaryotes
vdi01100  Metabolic pathways
vdi01120  Microbial metabolism in diverse environments
vdi01200  Carbon metabolism
Module
vdi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vdis_0679
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Vdis_0679
   00680 Methane metabolism
    Vdis_0679
Enzymes [BR:vdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Vdis_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADN50074
UniProt: E1QNA4
LinkDB All DBs
Position
complement(658232..659767)
Genome map
AA seq 511 aa AA seqDB search
MNLIPRSMCTQHPDNARVPDWARDSIIQGDDEVHEAYLAYSLYGCHEVMWDFEGKDVDIY
VVRKLLSRYPGFFRDHVLGRDVYLTLRLPNPWAETAEKKLFSQALELIPTAYDVAREFYG
TDDINGVFQVILPLTSRAEELVFTYRYYERVVAGKAFIELTPGVRVMDVLGSVRPSTIDV
IPLIEDLGSMLNVGKIIIGYWRVVRPSYLRIFIARSDPAMNYGLIPAVLMAKIALNKALN
LGRELGLEIYPIIGVGPTPFRGNLTPHNVDNVVREYPCVHTFTVQSAFRYDYPEGEVINA
ISKLNNRKPDGGCDIPNHGVLINVINKYVVNYQREIEGLANVINRVSNYVPRRRARKLHI
GLFGYSRGFRGVVLPRAITFVAALYSLGIPPEVLGVSTINELSDREYSALSEAYVNLRHD
LSMAARYVCHECLDMLTKLGNSFGITREVIDMVKRDIKTLEEMGIKTGPSDYDSRKHELL
TQLFINSLVEGKEDDAVKYMVEMALIRHAIG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcattccaaggagcatgtgcacgcagcacccggacaacgccagagtacctgac
tgggctagggatagtattatccagggggatgacgaggttcacgaggcttacctagcatac
agtctatatggttgtcatgaggtcatgtgggacttcgagggtaaggacgtggatatctac
gtggtcaggaaactactcagtaggtacccaggcttcttcagggatcacgtcctaggcagg
gacgtgtatttgacacttaggttgccgaatccctgggctgagaccgccgagaagaagcta
ttttcgcaagcccttgagttaatacccacggcctacgatgtggccagggagttctatggc
actgatgacattaatggggtattccaggtaatacttccattaacctcgagggccgaggaa
ctcgtatttacgtataggtattacgagagggtcgtcgccggtaaggcattcattgagtta
acccctggtgtcagggtcatggatgtcctgggcagtgttaggccgagcacaatagacgtg
atacccctcatagaggacctgggctcaatgcttaatgttggcaaaataatcattggttat
tggagggtggttaggccgagctaccttaggatattcatagccaggtcggacccagcaatg
aactacggcttaatacccgcagtcctcatggcgaaaatagccctcaataaggcgttgaac
ctgggcagggaacttgggcttgagatatacccaataattggcgttggcccaacaccattt
aggggcaacttaacgccacacaacgtggataacgtcgttagggagtacccatgcgtacac
accttcaccgttcagtcggcatttaggtacgactacccagagggtgaggtcattaacgcc
atttcgaagctgaacaataggaagccggacggtggctgtgatattcctaaccatggggtg
ctcattaacgtaattaataagtacgtggttaattaccaaagggagattgagggacttgcg
aacgttataaatagggtttcaaactacgtacctaggaggagagccaggaaattgcacata
ggcctattcggctacagcaggggctttaggggcgtggttcttcctagggctatcacgttc
gttgctgcgctatattcgttaggcataccgcctgaggtgttgggtgtttccacaattaat
gaattgagtgatagggagtattcagcgttgagtgaggcctatgtaaacctaaggcatgac
ctaagcatggcggctaggtacgtatgccacgagtgcctggacatgctcacgaaattaggt
aattcctttgggatcaccagggaggtcattgacatggttaagagagatattaagacgctt
gaggagatgggcattaaaacagggcccagcgactacgatagtagaaagcatgagttgttg
actcaattattcattaattcattggttgagggtaaggaggatgacgctgttaagtacatg
gttgagatggcgttgataaggcatgcaataggctaa

DBGET integrated database retrieval system