KEGG   Vulcanisaeta distributa: Vdis_1519Help
Entry
Vdis_1519         CDS       T01313                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vdi  Vulcanisaeta distributa
Pathway
vdi03030  DNA replication
vdi03410  Base excision repair
vdi03420  Nucleotide excision repair
vdi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vdi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Vdis_1519
   03410 Base excision repair
    Vdis_1519
   03420 Nucleotide excision repair
    Vdis_1519
   03430 Mismatch repair
    Vdis_1519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vdi03032]
    Vdis_1519
   03400 DNA repair and recombination proteins [BR:vdi03400]
    Vdis_1519
Enzymes [BR:vdi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Vdis_1519
    6.5.1.6  DNA ligase (ATP or NAD+)
     Vdis_1519
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Vdis_1519
DNA replication proteins [BR:vdi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Vdis_1519
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Vdis_1519
DNA repair and recombination proteins [BR:vdi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Vdis_1519
   NER (nucleotide excision repair)
    Other NER factors
     Vdis_1519
   MMR (mismatch exicision repair)
    Other MMR factors
     Vdis_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ADN50904
UniProt: E1QTB1
LinkDB All DBs
Position
complement(1439954..1441777)
Genome map
AA seq 607 aa AA seqDB search
MSTGSNDIKFIDVVKALESIEATTQRTVMAKLLSSLLKKTPPNVIDKVIYFILGQLRPDW
EGVELGVAEKLTFRAIANATGAPIKQIEDLYKRLGDVGETARRIMSSKPQQGGGKSILEF
FGGGGGEELTMGKVYDTLMSIARASGEGAQDTKVKLLTYLFSRAKPEEAKYIARFVIGRL
RLGVADMTILDALSDAYKVPREALERAYHIYPDLGYIAKMVAQEGQNALAKIHVTPGVPI
QPMLAERLSTSTEILAKLGGVAMVEYKYDGERAQIHKTRDGEIRIFSRRLENITHAYPDV
AEYVKEAIDAKEYIVEGEIVAIDPDTGEFRPFQELMHRKRKHDIKEAMKEYPVNIFLFDI
MYIDGQDLTNLPLIDRKRKLLEVLKPSEYVHLATWRIINDAEELDKFFHEAISDGCEGVM
CKSIKADSIYEMGARGWLWIKYKRDYRSELTDTLDLVVVGAFWGRGKRAGTYGALLIAAY
DPKTDQFYTVSKVGSGFTDEDLVKLKQMLDPYRIPHKHPRVVSKMEPDVWFVPAVVLEII
GAEITLSPLHTCCMGAIRPGVGLAIRFPRFTGRYRTDKSPEQATTVDEILEMYKEQKKVK
IEEGANP
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaggcagtaatgacattaagttcatcgatgtggtgaaggcgcttgagagtatt
gaggcaactacccagaggactgtcatggctaagctactctcatcactccttaagaagacc
ccacctaacgttattgataaggtaatttacttcatactcggtcaattaaggcctgactgg
gagggcgtagaactcggtgttgctgagaagctcaccttcagggctatcgccaacgccact
ggagcgcccattaagcagattgaggacctctataagaggcttggggatgttggtgagacc
gccaggaggataatgagtagtaagccgcagcagggtggtggtaagtcaatacttgagttc
tttggtggtgggggtggcgaggagttgacaatgggtaaggtttatgatacgttgatgtcg
atagccagggcgagtggtgagggtgcccaggatacgaaggttaaactcctcacgtactta
ttctcaagggctaagcctgaggaggctaagtacattgccaggtttgtgatcggtaggttg
aggcttggcgtcgctgacatgacgattctcgatgctttgtcggatgcgtataaggtgccc
agggaggcccttgagagggcctatcacatttacccagaccttggttatatagctaagatg
gtcgctcaggagggtcagaacgccctagctaagatccacgtgacacctggcgtaccaata
caaccaatgctcgctgaaaggttgagtacatctacggagattctggccaaattggggggt
gttgctatggttgagtataagtatgatggggagagggcccaaatacataagacgagggat
ggggagattaggattttcagcaggaggcttgagaatataacgcatgcctacccggacgtt
gctgagtatgttaaggaggccattgatgccaaggagtacatagtggagggtgagatagta
gccattgacccggacacgggcgagtttaggcccttccaggagttgatgcataggaagagg
aagcatgatattaaggaggcgatgaaggaatatccggttaacatattcctgtttgatatc
atgtatattgatggccaggacttaacaaacctgccgctcattgataggaagaggaagttg
ttagaggttcttaagcccagtgagtatgttcacttggcaacgtggaggataataaatgat
gcagaggagcttgataaattcttccatgaggcaataagcgatggttgtgagggggtcatg
tgcaagtccattaaggctgactcgatatatgaaatgggggccaggggttggctctggatt
aagtataagcgtgattataggagtgagttaacggatacacttgacctggtggtcgttggt
gccttctggggtcgtggtaagagggcgggcacgtacggcgcactactcattgctgcctat
gatcctaagacggaccagttctacactgtgagtaaggttggtagtggatttactgatgag
gatctcgtgaagctaaagcagatgcttgatccatataggataccgcataagcatccaagg
gttgtctccaagatggagcctgacgtgtggtttgtaccagccgtggtccttgaaataatt
ggcgcggaaataaccctaagcccactccacacctgttgtatgggcgctattagacctggc
gttggactagccattaggttcccaaggttcactggacgttacaggaccgataaatcgcct
gagcaggccacaacggttgatgagatactcgagatgtataaggagcagaagaaggtaaag
attgaggagggcgctaacccataa

DBGET integrated database retrieval system