KEGG   Veillonella dispar: NCTC11831_00782Help
Entry
NCTC11831_00782   CDS       T05848                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vdn  Veillonella dispar
Pathway
vdn00473  D-Alanine metabolism
vdn00550  Peptidoglycan biosynthesis
vdn01100  Metabolic pathways
vdn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vdn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCTC11831_00782 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC11831_00782 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NCTC11831_00782 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vdn01011]
    NCTC11831_00782 (ddl)
Enzymes [BR:vdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NCTC11831_00782 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:vdn01011]
 Precursor biosynthesis
  Amino acid ligase
   NCTC11831_00782 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N GARS_A RimK ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATP-grasp TIP49 ATPgrasp_Ter ATPgrasp_ST Nrap_D6
Motif
Other DBs
NCBI-ProteinID: VEG93352
LinkDB All DBs
Position
1:842145..843077
Genome map
AA seq 310 aa AA seqDB search
MKDKKIIVLMGGPSKEAEVSRRTGAAIAEALESKGYNAQTLELNPRTVLKDIEALGGEVV
FNAIHGRYGEDGALQGLLEMAEIPYTGSGIMAHAVGMNKKVSKDVFKGANIPTAASESFN
GNLESAEAIIEHIRKDFTIPVVVKSATQGSSIGVTIVRDEAQLEAAVTEALKYDPILVVE
QFLDGREFTVSVLDGKALSVIEIRPHSGEYDYKSKYTVGATEYLVPAPISEEMTAEMQRI
GELVYREVQGSGVVRVDVMTDHADKMYVLEYNTVPGMTATSLVPKAAKEMGIDFPTLCEK
ILLTASIGKF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaaaaaataatcgtattgatgggtggtccttccaaagaggcggaagtatct
cgccgtactggtgcggctattgcggaagcacttgaaagcaaaggttataatgcccaaaca
ttagaacttaatccacgtactgttttaaaagatattgaagccctcggtggtgaagtagta
ttcaatgccattcacggccgttatggtgaagacggtgcattacaaggcttattagaaatg
gctgaaattccatacactgggtccggtattatggctcatgcagtagggatgaataaaaaa
gtaagtaaagatgtgtttaaaggtgccaatattcctacggcggcttccgagtccttcaat
ggcaatcttgaatctgcagaggctattattgaacacatccgtaaagattttacaattcca
gtagttgtgaaatctgccactcaaggttctagtattggggttactatcgttcgcgatgaa
gctcagttagaagcggctgtaacagaagctcttaaatatgaccctattctcgtggtagaa
caattccttgatggtcgtgaatttacagtatctgttttagatggtaaagcattgtctgtt
attgaaattcgtccacattctggtgaatacgactacaagagtaagtatactgtaggtgct
accgagtatttagtgccagcacctattagtgaagaaatgactgctgaaatgcaacgcatt
ggggaacttgtgtatcgcgaagtacaaggcagtggggttgttcgtgttgatgttatgaca
gatcatgccgataagatgtatgttcttgaatataacactgtgcctggtatgacagcaacg
tctttagtaccaaaagcagctaaagaaatgggaattgacttcccaacattatgtgaaaaa
attctattaacagctagtatagggaaattttaa

DBGET integrated database retrieval system