KEGG   Veillonella dispar: NCTC11831_01868Help
Entry
NCTC11831_01868   CDS       T05848                                 

Gene name
frdB
Definition
(GenBank) Fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vdn  Veillonella dispar
Pathway
vdn00020  Citrate cycle (TCA cycle)
vdn00190  Oxidative phosphorylation
vdn00650  Butanoate metabolism
vdn01100  Metabolic pathways
vdn01110  Biosynthesis of secondary metabolites
vdn01120  Microbial metabolism in diverse environments
vdn01130  Biosynthesis of antibiotics
vdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCTC11831_01868 (frdB)
   00650 Butanoate metabolism
    NCTC11831_01868 (frdB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCTC11831_01868 (frdB)
Enzymes [BR:vdn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NCTC11831_01868 (frdB)
    1.3.5.4  fumarate reductase (quinol)
     NCTC11831_01868 (frdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_9 Fer4_7 Fer4_17 Fer2 Fer4_13 Fer4_16 Fer4_10
Motif
Other DBs
NCBI-ProteinID: VEG94391
LinkDB All DBs
Position
1:complement(1951548..1952510)
Genome map
AA seq 320 aa AA seqDB search
MRQITYHIHRYQQGRAFVQTFKFDYEADRTILWGLQKIKDTQDPTLTFLAACRSAVCGAC
SIRVNGEAMLGCEAKIDELTERYGTDELTIAPIGNFRVIRDLVVDWEAKVDRLKTVAPWI
FLKAEFNEGDKIVRQTPADFKKFVAGTECILCGCCASECNKLTARQDDFLEPYVFTKANR
FVLDSRDDAPMAHIQPAFDNGLWKCVHCMNCISRCPKHLKPAQDISNLRKEATKAGLTNS
KGVRHAVAFKDDLYKTGRLKEVSMSLKSDGVVDSAKQAFYALRLWKHSKINPFELVVPQK
PVNGIDGVRRLMKAAEEVSK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaatcacctaccatattcaccgttaccaacaaggtcgcgcgtttgtacagact
ttcaaattcgactatgaagctgaccgtacaattctttggggccttcaaaaaattaaagat
actcaagatccaactttaacattcttggcagcttgccgttccgcagtttgcggcgcttgc
tccattcgcgtaaatggcgaagcaatgcttggttgcgaagctaaaatcgacgaattaaca
gaacgttatggtactgatgaattgacaattgcacctatcggcaacttccgcgttatccgt
gacttagttgttgactgggaagcaaaagttgatcgtttgaaaacagttgctccttggatt
ttccttaaagcagaattcaacgaaggtgacaaaatcgttcgccaaactccagctgacttc
aaaaaattcgttgctggtacagaatgtatcctttgtggttgctgcgcatctgaatgtaac
aaattgactgcacgtcaagatgacttcttagaaccatatgtattcacaaaagctaaccgt
ttcgtattggatagccgtgatgatgcacctatggctcacattcaacctgcattcgacaac
ggtctttggaaatgcgttcactgcatgaactgtatctcccgttgccctaaacacttaaaa
cctgctcaagatatttccaacttgcgtaaagaagctacaaaagctggtcttactaacagc
aaaggcgttcgccatgcagttgctttcaaagacgatctctacaaaactggtcgcttgaaa
gaagtttctatgagcttgaaatctgatggtgttgttgattccgctaaacaagcattctat
gctttacgtttgtggaaacacagcaaaatcaatccattcgaacttgtagtacctcaaaaa
ccagtaaatggtattgatggtgttcgcagacttatgaaagcagctgaggaggtaagcaaa
taa

DBGET integrated database retrieval system