KEGG   Veillonella dispar: NCTC11831_01869Help
Entry
NCTC11831_01869   CDS       T05848                                 

Gene name
sdhA_2
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vdn  Veillonella dispar
Pathway
vdn00020  Citrate cycle (TCA cycle)
vdn00190  Oxidative phosphorylation
vdn00650  Butanoate metabolism
vdn01100  Metabolic pathways
vdn01110  Biosynthesis of secondary metabolites
vdn01120  Microbial metabolism in diverse environments
vdn01130  Biosynthesis of antibiotics
vdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCTC11831_01869 (sdhA_2)
   00650 Butanoate metabolism
    NCTC11831_01869 (sdhA_2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCTC11831_01869 (sdhA_2)
Enzymes [BR:vdn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NCTC11831_01869 (sdhA_2)
    1.3.5.4  fumarate reductase (quinol)
     NCTC11831_01869 (sdhA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO Thi4
Motif
Other DBs
NCBI-ProteinID: VEG94392
LinkDB All DBs
Position
1:complement(1952512..1954230)
Genome map
AA seq 572 aa AA seqDB search
MEQFDVLVVGSGGAGQRAALEVGRRKGLNVALITKIFPTRSATAMAQGGVNACLNNVAAE
DTIETHTFDTVKGSDYLGDQDAIEFFCSRCPEGVLEMDHMGAPFSRTQENKIAQRNFGGQ
SYPRTCYSADKTGHVILHTTYEQCLKEGVHFLQEWYLLDLVKDANGHVGGAVVWNMKEGR
VEQIKAKAVILSTGGAGRIFWTRTTNPFLSTGDGMAAAFRAGNALKDMEMIQFHPTGLGR
TGILMSEAVRGEGGYLLNAEGERFMKKYAPNKMELASRDVVAKAIEDEIAAGRGFGSGLN
AYVVADLRHLGPEVIIEKLHGIRDLAMTFEHCDPLVQPVPIRPTCHYTMGGIDVVDYKTC
ACELPGLFSSGEASCISIHGANRLGGNSLADGVVFGKVSGAGAADYAETHEQPNVDAELA
AAAKAWEAKFTEVTTREGGRPVVEIRDALADAMWNKVGIFRNEDGITEALKEIDQLIEDY
KTCYVGDPERTYNMAFVNYCEIGSMLTVAKAIAMGALHRRESRGAHIREDHPKRNDERYL
KHSLIKLGANGEYELTERDVVFTKYEPQERKY
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtttgatgttctagtagtaggtagcggtggcgctggtcaacgcgcggctctt
gaagttggtcgtcgcaaaggcttaaatgtagctcttattactaaaattttcccaactcgc
tctgcaacagcaatggcgcaaggcggtgtaaatgcatgtttgaacaacgttgcagctgaa
gacacaatcgaaacacatactttcgacacagtaaaaggttctgactatcttggcgaccaa
gatgcgatcgaattcttctgctctcgttgtccagaaggcgtacttgaaatggaccacatg
ggtgctccattctcccgtactcaagaaaacaaaattgcgcaacgtaacttcggtggtcaa
tcctatccacgtacttgctactctgcggataaaactggtcacgttattttgcacacaact
tacgaacaatgcttgaaagaaggcgtacacttcttacaagaatggtaccttttagatctt
gttaaagacgcaaacggtcacgttggtggcgcagttgtgtggaacatgaaagaaggtcgc
gtagaacaaattaaagcaaaagcagttatcttgtctactggtggtgcaggtcgtattttc
tggactcgtactacaaacccattcctttccacaggcgatggtatggcagcagcattccgc
gctggtaatgcattgaaagatatggaaatgatccaattccatccaactggtcttggtcgt
actggtatcttgatgtctgaagcggttcgtggtgaaggtggttaccttcttaacgctgaa
ggcgaacgtttcatgaaaaaatatgcgcctaataaaatggaattagcatcccgtgacgtt
gtagcgaaagcaatcgaagatgaaatcgctgcaggtcgtggtttcggttctggtcttaac
gcatacgtagtagctgaccttcgtcacttaggtcctgaagttatcattgaaaaacttcat
ggtatccgtgacttggctatgactttcgaacattgcgatccattagtacaaccagtacct
attcgtcctacatgtcactatacaatgggcggtatcgacgtagttgattacaaaacttgt
gcatgtgaattgcctggtttgttctcctccggcgaagcttcttgtatctccatccacggt
gctaaccgtttaggtggtaactccttggcagacggcgtagtattcggtaaagtatccggt
gctggcgcagctgactatgctgaaacacatgaacaacctaacgtagatgcagaattagct
gcagctgcaaaagcttgggaagctaaattcactgaagtaacaactcgtgaaggcggtcgt
cctgtagttgaaatccgcgatgcattggctgatgcaatgtggaacaaagtaggtatcttc
cgtaatgaagacggtattactgaagcattaaaagaaatcgatcaattgattgaagattac
aaaacttgttatgtaggtgaccctgaacgtacttacaacatggcattcgttaactattgt
gaaatcggttccatgttaacagtagctaaagctattgctatgggcgctttacaccgtcgt
gaatctcgtggtgctcatatccgtgaagaccatccaaaacgtaatgatgaaagatactta
aaacactctttgatcaaattgggtgctaacggcgagtacgaattgactgaacgcgacgta
gtgttcactaaatacgaaccacaagaaaggaagtactaa

DBGET integrated database retrieval system