KEGG   Verminephrobacter eiseniae: Veis_0524Help
Entry
Veis_0524         CDS       T00460                                 

Definition
(GenBank) Type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
vei  Verminephrobacter eiseniae
Brite
KEGG Orthology (KO) [BR:vei00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:vei02048]
    Veis_0524
Enzymes [BR:vei01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Veis_0524
Prokaryotic defense system [BR:vei02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Veis_0524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XhoI Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: ABM56308
UniProt: A1WFA1
LinkDB All DBs
Position
590086..590466
Genome map
AA seq 126 aa AA seqDB search
MPLNLCDYENKTSDAIKAFWQTRDDARSKQKESGKADQGERAAVTGGKNMHGVSRLVVDL
VKANGLPNAQVHQQRAVLTLPGYFRPTKLWDLLVIDNGRLIAAVEFKSHVGPSFGNDFNN
RTGSPG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
gtgccattgaatctctgcgactacgaaaacaaaacgagtgacgcgatcaaggcgttttgg
caaacaagggacgacgccaggtcaaagcaaaaggagtccggcaaggccgaccagggcgag
cgggccgcagtgactggcggcaagaacatgcacggcgtttcgcgtcttgtggtcgatctg
gtcaaggccaacggtctgccgaatgcacaggtacatcagcagcgggcggtgctgaccttg
ccgggctactttcgcccgaccaaactgtgggatttgttggtgatcgacaacgggcggctg
atagcagccgtcgaattcaagagccatgtcggcccctcgttcggcaacgacttcaacaac
cgcaccggatcgcccggctga

DBGET integrated database retrieval system