KEGG   Verminephrobacter eiseniae: Veis_1091Help
Entry
Veis_1091         CDS       T00460                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vei  Verminephrobacter eiseniae
Brite
KEGG Orthology (KO) [BR:vei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Veis_1091
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Veis_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO Glutaredoxin FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABM56867
UniProt: A1WGW0
LinkDB All DBs
Position
complement(1216198..1217805)
Genome map
AA seq 535 aa AA seqDB search
MLDETLKTQLSTYLERVTQPLELQACLDDSQTAREMRELLQTIAALRSDMIHLRTDGSDA
RQPSFSLRRAGSQMQLRFAGLPLGHEFNSLVLALLWAGGHPPKVGQELIEQVQALDGDLR
FEVYMGLDCHNCPDVVQALTLMAVLNPRISTTVIEGGAFRQEVSEREVMAVPTVFMNGRF
FASGRMMLEEILARLDTGAAARDAARLSAKAPYDMLIVGAGPAGVAAAVYAARKGLRTGL
VTERFGGQVNDTLAIENYIGVPQTDGPRYASALQAHLRAYDVDLMNLQRAGQLVAPAQPG
GLTTVQLANGGALKARTVILSTGARWRNVNVPGEAEYRNKGVTYCPHCDGPLFKGKRTAV
IGGGNSGVEAAIDLAGIVAHVTLIEFAEQLKADAVLVDRLKSLPNVSIHTNAQTTCITGA
GGKVDGIRFRDRATGLEHGVELDGVFVQIGLVPNTDWLKGQVALSPSGEVVIDARGQTSL
PGVFAAGDCTTVPYKQIVIAAGDGAKAALSAFEHLIRMPVAAAAAVPAAADPVLA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgaaacactcaagacccaactgtccacctatctggagcgcgtgacgcagccg
ttggaactgcaggcctgcctggacgacagccaaaccgcgcgcgagatgcgggaactgctg
caaaccatcgctgcgctgcgcagcgacatgattcatctgcgcaccgacggcagcgatgcg
cgccagccctcattcagcctgcgccgtgccggcagccagatgcaactgcgctttgccggc
ttgccgctgggccatgagttcaattccctggtgctggccctgctgtgggccggcggccat
ccgcccaaggtcgggcaggaactgatcgagcaggtgcaggcgctcgatggcgacctgcgc
tttgaggtctacatgggcctggattgccacaactgcccggatgtggtgcaggccctgacg
ctgatggccgtgctcaaccccaggatcagcaccaccgtcatcgaaggcggcgccttccgg
caggaggtgagcgagcgcgaggtcatggccgtgcccacggtgttcatgaacggccggttc
tttgcctcgggccgcatgatgctggaagaaatcctggcccggctcgacaccggcgccgcc
gcccgtgacgcggcccggctatcggccaaggccccttatgacatgctcatcgtcggagcc
ggccctgccggcgttgccgctgcggtgtatgcggcccgcaagggcctgcgcaccggcctg
gtcaccgagcgctttggcggccaggtgaacgacacgctggccatagagaactacatcggg
gtgccgcagaccgacggcccccggtatgcgagcgcgctgcaagcccatctgcgcgcctat
gacgtggacctgatgaacctgcagcgcgccggccagttggttgcgcccgcgcagcccggc
ggcctgaccaccgtgcaactggccaatggcggcgcgctcaaggcccggacggtgatcctg
tctaccggcgcccgctggcgcaatgtgaatgtgcccggcgaggccgagtaccggaacaag
ggcgtgacctattgcccgcattgcgatggcccgctgttcaagggcaaacgcacggcggtg
atcggcggtggcaattccggcgtcgaggccgcgatcgatctggccggcatcgtggcccat
gtcacgctgatcgaatttgccgagcagctcaaggccgacgcagtgctggtcgaccggctc
aagagcctgcccaacgtgagcatccacaccaacgcgcagaccacctgcatcacgggcgcc
ggcggcaaggtcgatggcatccggttccgggaccgcgccaccggcctggagcatggcgtg
gagctcgatggcgtgttcgtgcagatcggcctggtgcccaataccgactggctcaagggc
caggtcgcgctgagcccgtccggcgaggtcgtgatcgatgcccggggccagaccagcctg
cccggcgtgtttgccgcaggcgactgcaccacggtgccgtacaagcagatcgtcatcgcc
gcaggcgacggggccaaggcggcgctcagtgcgttcgagcatctgatccgtatgccggtg
gctgctgctgcggcggtgccggcggcggctgatccggtgctggcgtag

DBGET integrated database retrieval system