KEGG   Verminephrobacter eiseniae: Veis_1262Help
Entry
Veis_1262         CDS       T00460                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
vei  Verminephrobacter eiseniae
Brite
KEGG Orthology (KO) [BR:vei00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:vei03012]
    Veis_1262
   03029 Mitochondrial biogenesis [BR:vei03029]
    Veis_1262
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vei04147]
    Veis_1262
Translation factors [BR:vei03012]
 Eukaryotic Type
  Elongation factors
   Veis_1262
 Prokaryotic Type
   Veis_1262
Mitochondrial biogenesis [BR:vei03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Veis_1262
Exosome [BR:vei04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Veis_1262
  Exosomal proteins of breast cancer cells
   Veis_1262
  Exosomal proteins of colorectal cancer cells
   Veis_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ABM57030
UniProt: A1WHC3
LinkDB All DBs
Position
1404246..1405436
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSTKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELLDKYDFPGDDTPIIRGSAKLALE
GDKGVQGEQAIMKLAHALDTYIPTPERAIDGTFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIRDTQKTICTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPADKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKILA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggaaagttcgagcgcaccaagccccacgtcaacgtgggcaccatcggtcac
gtcgaccatggcaagacaacgctgacggcggccatcgccaccgtgctgtctaccaagttc
ggcggcgaagccaaggcttatgaccagatcgatgcagcgcccgaagaaaaggcccgtggc
atcaccatcaacaccgcccatgtggaatacgagacggccaaccgccactacgcccatgtc
gactgccccggccacgccgactatgtgaagaacatgatcaccggcgccgcccagatggac
ggcgccatcctggtgtgctcggccgccgacggccccatgccccagacccgcgagcatatc
ctgctggcccgccaggtgggcgtgccttacatcgtcgtgttcctgaacaaatgcgacatg
gtcgatgacgaagaactgctcgaactcgtcgagatggaagtgcgcgaactgctcgacaag
tacgacttccccggcgacgacaccccgatcattcgcggctcggccaagctggcgctcgaa
ggcgacaagggcgtgcaaggcgaacaagccatcatgaagctcgcgcacgcgctggacacc
tacatcccgacgcccgagcgcgcgatagacggcaccttcctgatgccggtggaagacgtg
ttctcgatctccggccgcggcaccgtggtcaccggccgcgtcgagcgcggcgtcatcaag
gtgggcgaagaaatcgaaatcgtcggcatccgcgacacgcaaaaaaccatctgcaccggc
gtggagatgttccgcaaactgcttgaccagggccaggccggcgacaacgtcggcctgctg
ctgcgcggcaccaagcgcgaagacgtggaacgcgggcaggtgctgtgcaagcccggctcg
atcaagccgcacacccacttcaccgccgaggtctacgtgctgagcaaggacgaaggaggg
cggcacacgccgtttttcaacaactaccggccgcagttctactttcgcaccacggacgtg
accggggccatcgagttgccggcggacaaggaaatggtgatgccgggcgacaacgtatcg
atcacggtcaagctgatcaacccgatcgcgatggaagaaggtctgcgctttgcgatccgc
gaaggcggccgcaccgtgggcgctggtgtcgtggccaagatcctggcctga

DBGET integrated database retrieval system