KEGG   Verminephrobacter eiseniae: Veis_3514Help
Entry
Veis_3514         CDS       T00460                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00010  Glycolysis / Gluconeogenesis
vei00620  Pyruvate metabolism
vei01100  Metabolic pathways
vei01110  Biosynthesis of secondary metabolites
vei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Veis_3514
   00620 Pyruvate metabolism
    Veis_3514
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Veis_3514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ABM59234
UniProt: A1WNM7
LinkDB All DBs
Position
complement(3886555..3888075)
Genome map
AA seq 506 aa AA seqDB search
MDMLEPGKFGTPVNFKKRYGNYIGGAWVAPVENQYFENITPVTGKPFCDIPRSTAADVER
ALDAAHKAKTAWGKTSPTERATILNKMADRIEQNLPMLAAAETWDNGKPIRETTLADIPL
AVDHLRYFASCIRAQEGSISQIDNDTYAYHLHEPIGVVGQIIPWNFPILMAIWKLAPALA
AGNCVVMKPAEQTPVSILVLMELVGDLLPPGVVNIVNGFGLEAGKPLASSNRIGKIAFTG
ETTTGRLISQYASQNLIPVTLELGGKSPNIFFADVMDKDDAFFDKALEGFAMFALNQGEV
CTCPSRVLVQESIYDRFIERAIGRVAAITQGSPLDMATMIGAQASSEQLEKILSYFDIGK
QEGARVLIGGERNLLKGDLEGGYYIKPTVFKGHNKMRIFQEEIFGPVVSVTTFKNEEDAL
EIANDTLYGLGAGVWSRDMNTAFRMGKGIQAGRVWTNCYHLYPAHAAFGGYKNSGIGREN
HKMMLNHYQQTKNLMVSYSENKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggacatgctcgaaccgggcaaattcggtaccccggtgaacttcaagaagcgctacggc
aactacatcggcggcgcatgggtcgcgccggtggaaaaccagtatttcgagaacattacg
ccagtgacgggcaagccgttctgcgatatcccgcgctcgaccgcagcggacgtggagcgc
gcgctggacgccgcgcacaaggcaaagaccgcgtggggcaagacctcgcccacggagcgg
gccaccatcctgaacaagatggccgaccggatcgaacagaatctgccaatgcttgcggcc
gcagagacttgggacaacggcaagccgatccgcgaaaccaccctggccgacataccgctg
gccgtcgaccacttgcgctacttcgcgtcttgcatccgcgcgcaggaaggcagcatcagc
cagatcgacaacgatacctatgcttatcacttgcacgagcccatcggagtggtcggccag
atcatcccctggaactttccgatcctgatggccatctggaaattggcgcctgcgctggcg
gcgggcaactgcgtggtcatgaagccggctgagcagaccccggtgtccatcctggtgctg
atggagttggtcggcgatttgctgccgccgggtgtggtcaacatcgtcaacggcttcggc
ctggaggccggcaagccgctcgcgtcgagcaaccgcatcggcaaaatcgccttcaccggc
gagaccaccaccggccggctgatctcgcaatatgccagccagaacctgattccggtgacg
ctggaactcggcggcaagtcaccgaacatcttcttcgccgacgtgatggacaaggacgat
gcgttcttcgacaaggcgctcgaaggctttgcgatgttcgcgctgaaccagggggaggtc
tgcacctgcccgtcgcgcgtgctggtgcaggagtcgatctacgaccgcttcatcgagcgc
gccatcgggcgggttgctgcgatcacgcagggcagcccgctggatatggccacgatgatc
ggcgcccaggcttccagcgagcagttggagaaaatcctgtcctacttcgacatcggcaag
caggaaggcgcacgggtgctgatcggcggtgagcgcaacctgctcaagggcgatctcgaa
ggcggctattacatcaagcctacggtgttcaagggccacaacaagatgcgcatcttccag
gaggagatcttcggccccgtcgtttcggtcacgaccttcaagaacgaggaagacgcgctg
gagatcgccaacgacacgctgtatggcctcggcgccggcgtgtggagccgcgacatgaac
accgcgttccgcatgggcaagggcatacaggccgggcgcgtgtggaccaactgctaccac
ctctacccggcccacgctgcgttcggcggctacaagaactcgggcatcgggcgcgagaac
cacaagatgatgctcaaccactaccagcagacgaagaacctgatggtgagctacagcgag
aacaagctcgggttcttctga

DBGET integrated database retrieval system