KEGG   Verminephrobacter eiseniae: Veis_3565Help
Entry
Veis_3565         CDS       T00460                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
vei  Verminephrobacter eiseniae
Brite
KEGG Orthology (KO) [BR:vei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Veis_3565
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     Veis_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABM59283
UniProt: A1WNS6
LinkDB All DBs
Position
complement(3941232..3942269)
Genome map
AA seq 345 aa AA seqDB search
MRNCEIHGARDLRIADRPAEPLAAHQVRVGVKAVGICGSDLHYYQHGRVGDFVIRAPLTP
GHEASGQVLELGAQVQGLQPGQRVALNPSRSCGVCRFCRAGAANHCENVHFFGSASKWPH
MQGAMREQVVLDAAQCIAVPDALSYEVAAFGEPLAVALHAVRQAGSLLGKSVMVVGAGPI
GALVLMAARLAGASALIAADIVDQPLAVCARVGATMSINLSRDAAALQALTQGRGQVDVC
FEVSGSHAALANCIRATRPCGTVVQVGSLGGSSEGCPFNQIMVKSLHYIGSFRFVDEYAW
AVDYLSRGLLDVAPLLTQALPVERVHEAFALAADRHQAMKVMVTF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaactgcgaaatccatggcgcgcgcgatctgcgcatcgccgaccggcctgccgag
ccgttggccgcgcaccaggtgcgcgtgggggtcaaggcggtcggtatctgcggctccgac
ctgcactactaccagcatggccgggtcggcgactttgtcatccgcgcgccgctgaccccg
gggcacgaggcttccggccaggtgctggaactgggcgcgcaggtgcagggcctgcaaccg
ggccagcgggtggcgctcaatccatcgcgcagttgcggtgtctgccgtttctgccgcgcc
ggcgcggccaaccattgcgaaaacgtccacttcttcggcagcgccagcaaatggccgcat
atgcagggtgcgatgcgcgagcaggtggtgctcgatgccgcgcagtgcattgccgtgccc
gacgcgctctcctacgaggtcgcggcttttggcgagccgctggcggtggcgctgcacgcg
gtcaggcaagccggctcgttgctgggcaagagcgtgatggtggtcggggccggcccgatc
ggcgctctggtgctgatggccgcgcgcctggccggtgccagcgcgctgatcgcggccgat
atcgtcgaccagcccctggctgtctgcgcccgggtgggggcgacgatgagcatcaacctg
agccgcgacgctgccgcgttgcaggcgctgacccagggccggggccaggtcgatgtctgt
ttcgaggtctcgggcagccatgccgcattggccaactgcatccgcgcgacacgcccgtgc
ggcaccgtggtgcaggtaggctcgctcggcggcagcagcgagggctgcccattcaaccag
atcatggtcaagagcctgcactacatcggcagtttccgctttgtcgacgagtacgcctgg
gcggtggattacctcagccgcggcctgctcgatgtcgcgccattgctgacgcaggcgctg
ccggtggagcgggtgcacgaagcctttgcgctggcggccgaccggcaccaggccatgaag
gtcatggtcacgttctga

DBGET integrated database retrieval system