KEGG   Verminephrobacter eiseniae: Veis_4114Help
Entry
Veis_4114         CDS       T00460                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
vei  Verminephrobacter eiseniae
Pathway
vei00061  Fatty acid biosynthesis
vei00780  Biotin metabolism
vei01100  Metabolic pathways
vei01130  Biosynthesis of antibiotics
vei01212  Fatty acid metabolism
Module
vei_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:vei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Veis_4114
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Veis_4114
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Veis_4114
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:vei01004]
    Veis_4114
Enzymes [BR:vei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Veis_4114
Lipid biosynthesis proteins [BR:vei01004]
 Fatty acid synthase
  Component type
   Veis_4114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_7 3HCDH_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABM59819
UniProt: A1WQB2
LinkDB All DBs
Position
4513399..4514178
Genome map
AA seq 259 aa AA seqDB search
MDLGIAGKTALVFGGSKGMGRACAQQLAREGVEVCIAARTQQTLALAAQEISAQTGHAVQ
YVVADITTPVGRDAALAACPAPDILVNNADGAPPGDFRQWTPADWHAALDSMMIGPIEMI
RRTVDPMIARRFGRIVNIVSRSVKTPQFELGLSNGARSGLVGFVAGLARQTVRHNVTINN
LLPGVFATDAQRRHIQGMVDSTGKSFDQLWQERGSNNPAGRYGEAEEVGALCAYICSAHT
GYITGQSILIDGGAYPGTY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggatctcggaatcgccggcaaaacagcactggtgttcggtggcagcaagggcatgggc
cgcgcctgcgcacagcagcttgcacgcgaaggcgtcgaggtctgcatcgctgcccgcaca
cagcagacgctggcgctggcggcgcaggagatttccgcgcagacaggccatgcagtgcag
tatgtcgttgccgacatcacgacgcccgtcgggcgtgatgccgcgctggcggcctgccct
gcgccggacattctggtcaacaacgcggacggcgcgccgccgggggattttcgccagtgg
acgcccgccgactggcatgccgcgctcgactcgatgatgataggcccgatagaaatgatc
cgcagaaccgtcgatccaatgatcgcccgcaggttcgggcgtatcgtcaatatcgtttcg
cgcagcgtcaagacgccccagttcgagttgggcctgtccaatggcgcgcgctccgggttg
gtgggtttcgttgccggtctggcgcggcagacggtgcgccacaacgtcaccatcaacaac
cttttgcccggtgtattcgccaccgatgcccagcgccgccacattcagggcatggtggac
agcacaggaaaatcgtttgaccagctctggcaggaacggggcagcaacaatcccgcaggc
cgatacggcgaggccgaggaagtgggcgcgctctgtgcttacatctgctctgcccacacg
ggatacatcacgggccagagtattttgatcgatggcggcgcgtaccccggaacctactga

DBGET integrated database retrieval system