KEGG   Vibrio sp. EJY3: VEJY3_04255Help
Entry
VEJY3_04255       CDS       T01683                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00220  Arginine biosynthesis
vej00250  Alanine, aspartate and glutamate metabolism
vej00290  Valine, leucine and isoleucine biosynthesis
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01130  Biosynthesis of antibiotics
vej01210  2-Oxocarboxylic acid metabolism
vej01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VEJY3_04255
   00290 Valine, leucine and isoleucine biosynthesis
    VEJY3_04255
   00220 Arginine biosynthesis
    VEJY3_04255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vej01007]
    VEJY3_04255
Enzymes [BR:vej01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VEJY3_04255
    2.6.1.66  valine---pyruvate transaminase
     VEJY3_04255
Amino acid related enzymes [BR:vej01007]
 Aminotransferase (transaminase)
  Class I
   VEJY3_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEX21349
UniProt: H2IH46
LinkDB All DBs
Position
1:complement(967062..968276)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIMMSMQALLNNGD
ELLIPAPDYPLWTASVALSGGKPVHYICDEESDWYPDLEDIKSKITPKTRGIVLINPNNP
TGAVYSRDFLLEFIEIARQHNLIIFADEIYDKVLYDGATHTSVATLTEDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAPGYIKGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAYELITQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGTGFNWPKPDHFRIVTLPHVEDLETAIGRFERFLTTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgataatgtctgctacgacattaggggtcct
gtactcaaacatgctaagcgcatggaggaagaagggcataaaatcctaaagctaaacatt
ggtaaccccgccccatttggttttgacgcccctgatgagattttagtcgatgtaatccga
aatctgccaacttctcaaggttactgcgattccaaagggatctattcagctcgtaaagcc
gtggttcagcattatcagcgtaaaggcattcgctctctagacgtagaagatgtctatgta
ggcaatggtgtatcagaattgatcatgatgtcgatgcaggcgctgttaaacaatggtgac
gagctgcttattcctgccccagattacccattgtggactgcttctgtggcactatcgggt
ggtaaaccggttcactatatttgtgatgaggaatcagactggtatccagatttagaagat
atcaagagtaaaatcacgccgaaaactcgcggcatcgttttaatcaacccgaacaaccca
acgggtgcggtttacagccgtgatttcctacttgaattcattgaaattgcacgtcagcac
aatctgattatttttgcagacgaaatctacgataaagttctttacgacggtgcgacacac
acctctgttgcgacactgactgaagacgtgctcgtgatgacgttcaacggcctgtcaaaa
gcataccgtgtatgtggcttccgcggtggctggatgttccttacagggccgaagcacctc
gcacctggctatataaaaggcctggagctgctctcatcaatgcgtttgtgtgcaaacgtg
ccaatgcagcacgcgatccaaaccgcactgggtggataccagagtatcaatgaactgatt
ttgcctggtggtcgcctgctcgagcagcgtaatcgcgcttatgagctgatcacgcaaatc
ccgggagtatcgtgcgttaagccgaaaggcgctatgtatctgttcccgaaaattgatacc
aagatgtacaacatcaaaaacgatcagcaaatggtgttggacttcctgaaacaagaaaaa
gtgcttttggttcagggcaccggctttaactggccaaaaccggatcacttccgtatcgtg
acactcccacatgtcgaagatcttgaaaccgcaatcggacgattcgaacgcttcttaacg
acttatagccagtaa

DBGET integrated database retrieval system