KEGG   Vibrio sp. EJY3: VEJY3_04675Help
Entry
VEJY3_04675       CDS       T01683                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
vej  Vibrio sp. EJY3
Brite
KEGG Orthology (KO) [BR:vej00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    VEJY3_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AEX21431
LinkDB All DBs
Position
1:complement(1063377..1064162)
Genome map
AA seq 261 aa AA seqDB search
MEMIEPGMLLVLALVAFVAGFIDAVAGGGGMLTVPTLLSLGLPPHIALGTNKLAATFASS
TAAFTYYKKRLFRPRCWGRSFVATLIGATVGTLFVDAISTEWLEKVLPLIILAAALYTVF
HKTPKTTHQSPIPEPCPRLHKKQYAQGFSLGFYDGLAGPGTGAFWTVSSMALYRLNILLA
SGLAKAMNFTSNFTSLITFAVLGHINWVLGLTMGLCLMAGAFVGAHSAIHFGAKFIRPVF
VTVVSILAIKLAYDAWFVGLT
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgattgagccaggcatgttgctggtgttggcgcttgtcgcttttgttgctgga
ttcatcgatgccgttgctggtggtggtggtatgctaaccgtcccaacgttgttatctttg
gggcttccaccccacatcgctctgggaacaaacaaactcgccgcgacgtttgcctcttcg
acggcggctttcacctactacaaaaagcgtttattccgcccaagatgctggggaagatcc
ttcgttgccaccctaataggagcaaccgttggtacgctgtttgtcgacgctatcagtacc
gagtggttagagaaagtattgccgctgatcatcttggcagctgctctatataccgttttc
cataaaacgccgaaaacgacacaccaaagtccaataccagagccgtgccctcgactacat
aaaaagcaatatgcacaaggcttttcacttggcttctacgatgggctggcaggtccgggc
acgggggcattctggacggtgagctcaatggcactctatcgactgaatatcctacttgct
tctggcctggcaaaagcaatgaactttaccagtaactttacttccctcattacttttgca
gtgttggggcatatcaactgggtgctaggcttaacgatggggctatgcttaatggcaggt
gcttttgtcggcgctcattctgcgattcactttggcgctaaattcattcgcccggtattc
gttaccgtggtgagcatacttgcgattaaattggcttatgatgcttggtttgtagggtta
acatga

DBGET integrated database retrieval system