KEGG   Vibrio sp. EJY3: VEJY3_05975Help
Entry
VEJY3_05975       CDS       T01683                                 

Definition
(GenBank) glutamate decarboxylase eukaryotic type
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00250  Alanine, aspartate and glutamate metabolism
vej00410  beta-Alanine metabolism
vej00430  Taurine and hypotaurine metabolism
vej00650  Butanoate metabolism
vej01100  Metabolic pathways
vej01110  Biosynthesis of secondary metabolites
vej01120  Microbial metabolism in diverse environments
vej02024  Quorum sensing
Module
vej_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VEJY3_05975
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VEJY3_05975
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VEJY3_05975
   00430 Taurine and hypotaurine metabolism
    VEJY3_05975
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VEJY3_05975
Enzymes [BR:vej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VEJY3_05975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS HSCB_C Aminotran_1_2 AAA_33 DUF5446
Motif
Other DBs
NCBI-ProteinID: AEX21689
LinkDB All DBs
Position
1:complement(1347305..1348951)
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIEEGLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYAQPNTFYDQWMHSANHSLGAFCSGGTIANITA
LWVARNKALKADGEFKGVEKEGLFKAMKHYGYEGLAIMVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKAKISELKKQNIKPIAVIGVAGTTETGNVDPLASIAEVCQEHD
CHFHVDAAWGGATLMSNHHRHLLNGIELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKKQDDFELVSEPELCLLTYRYLPPNIREALEKADGTQKEELNELINELTQFIQKRQRET
GKSFVSRTTLNPEHWERMSTIVFRVVLANPLTSTDIFDAVLDEQRLIAQQAPNLNAKIQE
LASKILAS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttattaaagatcttcact
gtccctgaaggtccggactcgacgttaacaaaaattgaagaaggtctctctcgaaacttg
aatcaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgtgaaatagagaaa
gacttttcttctgctcagattcctgagcaacctgagtttgtgtcagaccataccgagcac
ttgttagataccttggtgtcacactcggttcatacgtcagctccaagctttatcggccat
atgacatcggcattgccttactttttaatgccactgtctaaaattatgattgccttaaac
caaaacttggtgaagatagaaacgtcgaaagcgtttacgccattagagcgccaagtattg
ggcatgctgcaccgattaatctacgctcagccgaataccttttacgaccaatggatgcat
agtgccaaccattctctcggtgcgttctgctctggcggcacgattgcgaatattactgcc
ctttgggttgcccgcaataaagcattgaaagcagacggcgaatttaaaggtgtagagaaa
gaaggcctattcaaagccatgaaacattacggctatgaaggcttagctattatggtttct
gagcgtggtcactactcactaaaaaaagcggccgatgtactgggtttggggcaggaaggc
ctagtcgcagtaaagacggatgcaaataaccgcattattgtcgatgacctcaaagcgaaa
atcagcgaactcaagaagcaaaatatcaagccgattgcggtgattggtgtggcgggtacg
actgaaactggtaatgttgatccactcgcttcgattgctgaagtttgtcaagaacacgat
tgtcattttcatgtggatgccgcatggggtggcgcgacattaatgtctaatcatcaccga
cacctgctgaatggcattgagcttgcagactcagtgacgattgacgcgcataagcagctt
tatatccctatgggtgcgggcatggttctgtttaaagatccagatgcgatgaaatctatt
gagcaccacgctcagtacatcttgcgtaaaggttctaaagatttaggtagtcataccctg
gagggctctcgttctggtatggcgatgttggtgtatgcagcaatgcatattattagccga
cctggctatgaactgttgatcgatcaaagtatcgagaaagcacgctacttcgcggatttg
attaagaaacaggacgactttgaactggtttctgagccagagctatgtttgctcacctac
cgttatctaccgcctaacatccgtgaagctctagaaaaagcagacggtacacagaaagaa
gaattaaatgagttaatcaacgagttaactcagtttattcaaaagcgtcaacgtgaaact
ggtaagtcatttgtttctcgtaccacgcttaatcctgagcattgggagcgcatgagcact
atcgtcttccgggtagtcttggcaaaccctctgacctctacagacatctttgatgctgtt
ttggacgagcaaaggcttattgctcagcaagcaccaaacttaaacgccaaaatccaagaa
ctggcttctaagattttggcatcttga

DBGET integrated database retrieval system