KEGG   Vibrio sp. EJY3: VEJY3_06030Help
Entry
VEJY3_06030       CDS       T01683                                 

Definition
(GenBank) cysteine/glutathione ABC transporter membrane/ATP-binding component
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
vej  Vibrio sp. EJY3
Pathway
vej02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vej00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VEJY3_06030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vej02000]
    VEJY3_06030
Transporters [BR:vej02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    VEJY3_06030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N RsgA_GTPase DUF87 AAA_29 MMR_HSR1 Zeta_toxin AAA_16 NACHT AAA_22 AAA_23 AAA_30 AAA_25
Motif
Other DBs
NCBI-ProteinID: AEX21700
LinkDB All DBs
Position
1:complement(1360527..1362248)
Genome map
AA seq 573 aa AA seqDB search
MRDLLPYLKLYKKHWFGLSLGMLLAFLTLAASIGLLTLSGWFISAASVAGLTIARETFNY
MLPGAGVRGAAMARTAGRWGERVVSHNATFKLLTDLRIFFFEKLSPLIPGRVSTMRDADV
LNRLVADVDAMDHVYLRLISPVIIGIFGILSLTAVLAFFDWHLAMLLGSVLTVMLLVWPV
LFYKLGKKNGAHLTHRKAELRVATLDWLQGYSELSIFGAEERYRNLILDKQKQLLSNQFV
NANLTGMASGLLMLANGLTLVMMLWFAADGVGGRAPDPWIALFAFATMASFEILMPIAGA
FQYLGQTLTSARRLNEVILAKPDVVFPQQSSREDKPLDIEFDNISFAYPDGQQKVLNDLS
LSLPLGSKTAVVGQTGSGKSTLIQLLCRYWDVNQGEVRIGGASLKSWGESDLRSAITVVS
QRVDVLNGTLRDNLLMAAPDATDEQLADILTQVDLGGLLEEPGLSAWLGDGGRQLSGGEK
RRIGIARALLRDAPILLLDEPTEGLDKRTEQKVMALFNQHFANKTVVFITHRLIELENMD
NICLMEQGEIIEQGNHNALIAQQGRYFQLLQSL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatttactcccttacttaaaactgtataaaaagcactggtttggtttgtcatta
gggatgctattggcattcctgactcttgcagcttcaattggactgttgaccctttctggt
tggtttatttctgccgcttcagtcgcaggattaaccatcgcaagagaaacctttaactac
atgcttcctggtgctggtgtccgtggtgctgccatggcacgtacagctggccgttggggt
gagcgcgtggtgagccacaatgccacatttaagctgcttaccgatttacgtatattcttc
ttcgagaagctttctccgcttattccgggtcgagtttcaaccatgcgtgatgcggacgta
cttaaccgtctggttgctgatgtcgatgcgatggatcacgtctatttgcgccttatcagc
ccggtgataataggtatattcggtatcctgagtttaaccgcggtgctggcattctttgac
tggcacttggcaatgctgttaggttccgtactcactgttatgctgttggtttggccggtg
ctgttctacaaactcggcaaaaagaatggtgcacacctgacacatcgcaaagctgaattg
cgcgttgcgactcttgactggctgcaaggctatagcgagctcagtatttttggtgcagaa
gaacgttaccgcaacttgattttagacaagcaaaaacagctgctttccaatcagtttgtt
aacgcgaatctcactggtatggcatcaggtctactgatgttggctaacggtctgacgctg
gtaatgatgttatggtttgctgcggatggcgttggtggtcgagctccggatccatggatt
gcgcttttcgcctttgcaaccatggcaagtttcgaaatcctaatgcctattgcaggtgca
tttcagtatctgggtcaaaccttgacgtcggcacgccgtctgaatgaggttattcttgct
aaaccagatgttgtttttcctcagcagtcgagtcgtgaagacaaaccgttggatatcgag
tttgataacattagctttgcgtatccggatggccagcaaaaagtgctgaacgatttatcg
ctatctctgcctctgggttcaaaaaccgcagtggttggtcaaactggttcgggtaagtcg
actcttatacaactgctgtgtcgctactgggacgtgaaccaaggtgaagtacgtattggt
ggcgcatcactaaaatcttggggcgaatctgatttgcgttcagccattaccgtcgttagc
cagcgtgtagacgtactaaatggcacactgcgtgacaacctcctgatggctgcgcccgat
gcaactgatgaacaactggctgatattttaactcaggttgatcttggcggcctgcttgaa
gaaccaggcttaagcgcgtggttaggcgatggcggtcgtcagctctctggtggcgaaaaa
cgccgtattggcattgctcgagcgctgttacgtgacgcaccaattctgctgttagatgaa
ccgactgagggccttgataaacgcacggagcaaaaagtgatggcgttattcaaccagcac
tttgctaataagaccgtcgtgttcattacgcaccgactcatcgagctggagaatatggat
aatatctgcttgatggagcaaggggaaatcattgagcaaggcaaccacaatgcgttgata
gcgcaacaaggtcgctacttccaattgttgcagtctttatag

DBGET integrated database retrieval system