KEGG   Vibrio sp. EJY3: VEJY3_07070Help
Entry
VEJY3_07070       CDS       T01683                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vej  Vibrio sp. EJY3
Pathway
vej03030  DNA replication
vej03410  Base excision repair
vej03420  Nucleotide excision repair
vej03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vej00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VEJY3_07070
   03410 Base excision repair
    VEJY3_07070
   03420 Nucleotide excision repair
    VEJY3_07070
   03430 Mismatch repair
    VEJY3_07070
Enzymes [BR:vej01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VEJY3_07070
    6.5.1.6  DNA ligase (ATP or NAD+)
     VEJY3_07070
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     VEJY3_07070
DNA replication proteins [BR:vej03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    VEJY3_07070
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     VEJY3_07070
DNA repair and recombination proteins [BR:vej03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VEJY3_07070
   NER (nucleotide excision repair)
    Other NER factors
     VEJY3_07070
   MMR (mismatch exicision repair)
    Other MMR factors
     VEJY3_07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEX21904
UniProt: H2IC24
LinkDB All DBs
Position
1:1586120..1586962
Genome map
AA seq 280 aa AA seqDB search
MPIKMTLIALAIMASTHVQAHPTVAPLVSLAETYQDGIDVSQYWYSEKLDGIRAYWTGQH
LVTRNGNRIHAPKWFTAPLPDYPLDGELWAGRGNFHLVQQTVLDKTPVDSAWKKVDFMLF
DMPYSAGDYRKRYYNIQNLVYELDEPHIKYVEHMTIQDEEHLFSQLDKIALADGEGVMLR
KVSSRYQAGRGSDLLKLKRFADTEAQVIGHKPGTGRLLGMMGAILVRMPDGTEFYIGSGF
TDELRRNPPQLGSIITFRYNGFTHNGKPKFARFLRERSKE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcccataaaaatgacattgatcgcactcgccattatggcatccacgcacgttcaagcc
catccaactgtcgcgcctttagtctcgctagcagaaacctatcaagatgggattgatgta
tcgcaatactggtacagtgaaaaattggatggtattcgtgcctactggacggggcaacac
cttgtaacacgtaatggaaaccggatacacgctcctaagtggtttacagcaccattgcca
gattaccctctggatggtgaactttgggccgggcgaggtaattttcatttggtccagcaa
acggttctggacaaaacaccggtcgacagcgcgtggaagaaagtagattttatgttgttt
gatatgccttactctgcgggtgactatcggaagcgctattacaatatccaaaacttggtg
tatgagctggacgagccacacattaagtacgtcgagcatatgactattcaagatgaagag
cacttatttagccaattagacaaaatcgcgttagctgatggggaaggtgtcatgttacgc
aaggtgtctagtcgttaccaagcgggccggggcagtgatttacttaagttaaaacgtttt
gccgatacagaagcacaagtgatcggacataagcctggaactggtcgcttgttgggaatg
atgggcgcgattctggttcgtatgcctgatggtacagagttttatattggtagtgggttt
acagacgagttgcgccggaacccaccacaattaggctcgattatcacatttaggtacaac
gggtttactcataacggaaaacctaaatttgccagatttttgcgtgagcgttctaaagag
tag

DBGET integrated database retrieval system