KEGG   Vibrio sp. EJY3: VEJY3_10985Help
Entry
VEJY3_10985       CDS       T01683                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vej  Vibrio sp. EJY3
Brite
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VEJY3_10985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEX22677
UniProt: H2IHQ5
LinkDB All DBs
Position
1:2442790..2443374
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDAAINNFG
SSWTWLVKKADGSLDIVNTSNAATPLTEEGVTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcactagaaccacacatctca
gcagagactctagattaccaccacggtaagcaccacaacacttacgtagttaagctaaac
ggtcttattcctggtactgagttcgaaggcaaaactctagaagagatcatcaagacttct
actggtggcgtattcaacaacgctgctcaaatctggaaccacacgttctactggcactgt
ctagctccaaacgcgggcggcgagccaactggcgcagttgctgatgcaatcaacgcagca
ttcggttctttcgaagaattcaaagcgaagttcactgatgcagcaatcaacaacttcggt
tcttcatggacttggctagttaagaaggctgacggttctctagacatcgttaacacttct
aacgcagcaactcctctaacagaagaaggtgtaactccacttctaactgttgacctatgg
gaacacgcgtactacatcgattaccgcaacgtacgtcctgattacatgaacggcttctgg
gctcttgtaaactgggatttcgtagcagagaacctagcgaagtaa

DBGET integrated database retrieval system