KEGG   Vibrio sp. EJY3: VEJY3_11030
Entry
VEJY3_11030       CDS       T01683                                 

Definition
(GenBank) hypothetical protein
Organism
vej  Vibrio sp. EJY3
SSDB
Motif
Pfam: Med9 ApoLp-III
Other DBs
NCBI-ProteinID: AEX22684
LinkDB
Position
1:complement(2453099..2454262)
AA seq 387 aa
MSAHRIFSMMVMWVAMTISGCSLLSVKIDSQTVPLTKQELNMRILTREYALQYFAQVEQA
ADSLEAKYDPNDQINQSYILLWKINAEEGLQASAYQVTPMAGLIDTWVFAHQVDEFFATG
AGSNLFATDEAKNVSEHLANEVDKLAQSILKKEVYDNTKPFVANFVKQHPFADLSMIRTP
AYRAWLEFSQISEEEAVMTLGTMPEALGDVSDRLSLASKQAPKIMTWKAQLLALNSSASI
EKVNAALNSLQVTADSMRDFIDNNPEYMRYLAEQMALELQPLVDDIDMKTEARLSQLGEE
RQALEEMVARERQEIALIITHEREKFAQDIDRVSQQVVDLAMTKLIELVRSTIIYFILFI
IAIFFAPLGLGYVLGKRASVKANIKES
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgtctgctcatcgaatattttcaatgatggttatgtgggtggctatgacaatctctgga
tgttcacttttatcagtgaaaattgatagccaaaccgtaccgcttaccaagcaagagctc
aatatgcgtatattgacgagagaatatgcgttgcaatattttgctcaggtagagcaagct
gctgattctttagaagctaagtatgaccccaacgaccaaattaaccaatcttacattcta
ttatggaaaataaacgcggaagaaggcttacaggcctcggcttatcaggtcacccctatg
gctggcctgattgatacgtgggtattcgcgcatcaagtcgacgagttttttgctacagga
gcaggcagcaatctgtttgccacggatgaagccaaaaacgtctctgagcatttggcgaat
gaagtcgacaagctcgctcaatccatattaaaaaaagaagtgtatgacaatacaaaaccg
tttgtggctaatttcgtcaagcaacatccctttgctgacctgagtatgatcagaacgcca
gcctaccgggcatggttggaattttctcaaattagtgaggaagaagccgtaatgacgtta
ggaacaatgccagaagcgctaggggatgtgtctgatcggttaagtttagcgtctaaacaa
gcaccaaagatcatgacatggaaggcacaattactggcattaaacagctcagccagcatt
gaaaaagtcaacgcggcgctaaatagcctgcaagtgacagccgattcgatgagagacttt
atcgataataacccagaatatatgcgctatttggctgagcaaatggcacttgaacttcag
cctctggttgacgatatcgatatgaaaaccgaagctcgtctatctcagttaggtgaagag
cgtcaggcgctagaagaaatggtggcgagagagcgtcaggaaattgcgttgattattact
catgaaagagaaaaatttgcacaagatatcgatcgcgtctctcaacaggttgtcgatttg
gcaatgacaaaattgattgaactcgtcagaagcaccattatctatttcattctgttcatt
atcgcgatcttcttcgctccgctaggtcttggctatgtactgggcaagcgggcatccgtc
aaagcaaacataaaagaaagctag

DBGET integrated database retrieval system