KEGG   Vibrio sp. EJY3: VEJY3_12405Help
Entry
VEJY3_12405       CDS       T01683                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00564  Glycerophospholipid metabolism
vej01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VEJY3_12405 (glpD)
Enzymes [BR:vej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VEJY3_12405 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C 3HCDH_N Pyr_redox_2 K_oxygenase NAD_binding_8 FAD_binding_2 GIDA
Motif
Other DBs
NCBI-ProteinID: AEX22957
LinkDB All DBs
Position
1:2758206..2759765
Genome map
AA seq 519 aa AA seqDB search
MSIQKNASTTDSSTPLDLIIIGGGINGAGIAADAAGRGLSVGLYEANDFASATSSASSKL
IHGGLRYLEHYEFRLVSEALAEREVILRKAPHVALPMRFRLPHRPFLRPAWMIRCGLFLY
DNLGKRTTLPGSKTVNLAKSGLLKPEIKTGFEYSDCWVDDARLVLLNVLAARENHAEVRN
YCRVEKAHRESGIWHVTIHDTMTDQRFERKAKALVNAAGPWVKQFFDEGLEQASPRNIRL
IKGSHIVVPRIHNEPQAYILQNKDNRIVFMIPYLDKFSIVGTTDVEYKGDPREVAISDDE
VDYLIDIVNQHFVHQLSREDVVWTYSGVRPLCDDESDSPQAITRDYTLELDAEFDQAPLL
SVFGGKLTTYRKLGEAAMKKLAPFLPQMGGNWTANQALPGGNFSCSREQLAKQIHAKYAW
ASEALILRYVTQFGTQTWELMKGATSEADLGQAFSTQAGGVYQREIDYLMNHEMALTDED
ILWRRTKLGLYMSDEEKLSLAEYLKEKLQQKVVNLSQVG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgagtatacaaaaaaatgcttccacaactgactcatccactcctttagacttgatcatt
atcggtggcggcattaacggggctggtatcgctgctgatgctgcaggccgtggattaagt
gttggtttgtatgaagctaacgactttgcatctgcaacctcttcagcaagctccaaactt
attcatggtggattacgctaccttgaacactacgagtttcgtttagtttcggaagcgctc
gcagaacgtgaagtaatccttcgcaaagcacctcatgttgcgttacctatgcgtttccgt
ttacctcatcgtccatttttacgtccagcgtggatgatccgctgtggtttgttcctttac
gataacttgggtaaacgcactacgctcccaggcagcaagaccgttaatctggcaaagtct
ggcttattaaaaccagagataaaaacaggtttcgaatactccgactgctgggtagatgat
gctcgcttagttctacttaacgttctcgcagcacgtgaaaaccatgcagaagttcgtaac
tactgccgagtagaaaaagcgcatcgcgaaagcggcatctggcatgtcacaatccacgac
acaatgacggatcaacgttttgaacgtaaagcgaaagcactggttaacgctgcgggaccg
tgggtaaaacagttctttgatgaaggactagagcaagcttctccacgtaatattcgtttg
atcaaaggttcgcacattgttgttcctcgtatccacaacgaacctcaggcttatattctg
caaaacaaagacaaccgcatcgtgtttatgatcccgtacttagataagttctcaatcgtc
ggtaccacagatgtcgaatacaaaggcgacccacgagaagttgcgatctctgatgacgaa
gtcgattatctgatcgacattgttaaccagcacttcgtccaccagctatcgcgcgaagat
gtggtgtggacatacagcggtgtacgcccactgtgcgatgatgagtcagactcgccacag
gcgatcacgcgagactacacgttggaactcgatgcggaattcgatcaggctccattactt
tcggttttcggcggtaaactaacgacttaccgaaaactgggtgaagcggcgatgaaaaag
ctggcgccattcctgccacaaatgggcggtaactggacagcaaaccaagctctgccgggc
ggtaacttcagctgtagtcgcgaacaactggcgaaacagatccacgccaagtacgcctgg
gcatcagaagcgcttattttgcgttacgtcactcagtttggaacacaaacgtgggagcta
atgaagggagcgacaagtgaagccgatttaggccaagctttctctacacaagccggtggc
gtatatcagcgtgaaattgactacttgatgaaccatgaaatggccctgactgacgaagac
attttatggcgtcgtaccaagctcgggctctacatgagcgacgaagaaaagctatctctt
gcagaatacttaaaagaaaagttacaacagaaagtcgtgaacctctcacaagtgggctaa

DBGET integrated database retrieval system