KEGG   Vibrio sp. EJY3: VEJY3_12920Help
Entry
VEJY3_12920       CDS       T01683                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VEJY3_12920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vej01003]
    VEJY3_12920
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vej01011]
    VEJY3_12920
Enzymes [BR:vej01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     VEJY3_12920
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VEJY3_12920
Glycosyltransferases [BR:vej01003]
 Polysaccharide
  Bacterial polysaccharide
   VEJY3_12920
Peptidoglycan biosynthesis and degradation proteins [BR:vej01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   VEJY3_12920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AEX23060
LinkDB All DBs
Position
1:complement(2882779..2885151)
Genome map
AA seq 790 aa AA seqDB search
MTNTKKPSTKKAPAKKKTAAKSTATRNKRSPGKKPDNGKRSWLKTLWSFGWKAGVALAAV
LLFVGIYLDSVVKERFDGQLFELPTVVYARILNLSPGENITIKELRNELDVLNYRKVSTP
RYPGEYSSSSTRIELIRRPFEFADGPEPDRHVMLHFSDGGLQRIQSLESRGDLGYLRLEP
KMLGMLEKDQDEQRLFLRRDQFPEILVDALLATEDRNFYQHDGVSPLAIGRALVANIKAG
RTVQGGSTLTQQLAKNLFLTRDKTLWRKLREAYIALILDYRYSKDRILEAYLNEVYLGQS
GGEAIHGFGLASRYYFGQPISELRVDQLAMLVGMVKGPSYYNPIRYPERTKDRRDLVLRL
LMQQNLLTAQEYDQAASRPLDTQSNPRIASRQPAYFQQLNIELKEKVGERFKAETGLRVF
TSLDPVSQSKMEKAIAKKIPELAKRGGKDLEAAAVAVDRHSGEIRAMVGGKRAGYDGFNR
ALNASRPIGSLVKPAIYLTALEQPEKYNLGTTLHDTPLSLKGSEGTVWTPRNYDRKYRGD
VPLYLALAKSLNVPTVRLGMELGIPEVTNTLERLGVSKNEIRPVPSMFLGAFSLTPLEVA
QMYQTLTNSGKRARLTALRSVIDMEGNVLYQSLPRSSREVDEQAAWLTTYAMKQGVAQGT
GRYLQNQFSWAALAGKTGTSNDTRDSWFVGVDGREVTTIWLGRDDNKPTNLTGASGALRV
YAEYLSQRIPERLALPWPREVTTLGFKQKAEGGLEMNCRSEYKLPVWDKTGQVKQQCEKK
SNWINDLFNW
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgactaacactaaaaagccaagcacaaaaaaagcgcctgcgaagaaaaaaacagcagcg
aaaagtacggcaacacgtaacaaacgtagcccgggtaaaaagccggacaatggcaaacgt
tcgtggttgaaaacgttgtggtcgttcggctggaaagcgggtgttgcgctggctgcggta
ttgttattcgtcgggatctatttagatagcgtggtcaaagagcgctttgatggtcagcta
tttgaactgccaaccgttgtttacgcgcgtattctgaatttgagcccgggtgagaatatc
accatcaaagagctgcgcaatgaactggatgtactcaactatcgaaaggtgagcacgcct
cgttatcctggcgaatactcttcgtcttctacccgcattgaattaattcgtcgtccattt
gagttcgctgatggcccggagccagatcgtcacgtgatgctgcatttctctgacggtggt
ttacagcgcattcagtctttggaatccagaggggatcttggctatctgcgtcttgaacct
aaaatgctgggtatgttggagaaagatcaggacgagcaacgactgtttttacgtcgagac
cagttcccggaaattttggttgatgcgctactggctaccgaagaccgaaacttttatcaa
catgacggtgtttctccgctggccatcgggcgtgcgctcgttgcgaatatcaaggcaggc
cgcacggtccagggcggcagtacactgactcagcagttggcgaaaaacttatttcttacc
cgcgacaagacattatggcgtaagctacgtgaagcctacatcgcgttgattctggattat
cgctacagcaaagatcgtattctggaagcgtacttaaacgaagtgtatttagggcaaagt
ggcggtgaagcgatccatggctttggtttggcctcgcgttactactttggccagccgatc
agtgagctacgcgtcgatcaacttgccatgttagtcggtatggtcaaagggccgtcttat
tacaaccctattcgctatccagagcgaaccaaagatcgccgtgacctggtattgcgtctg
ttgatgcaacaaaatctactgacggcacaagagtatgatcaggcagccagtcgtccgctt
gatacgcaaagcaatcctcgtattgccagccgtcagcctgcgtacttccagcaattgaac
atcgagctgaaagaaaaagtcggtgaacgttttaaggcggaaacaggattaagagtcttc
acctcacttgatccggtatcgcaaagcaaaatggaaaaagccatcgcgaaaaagatccca
gagctggcaaagcgaggcggtaaagatctcgaagctgcagcggtggcagttgaccgccac
agtggagaaatccgcgcaatggttggcggtaagcgagcgggttatgatggatttaaccga
gcgctgaatgcgagccgtcctattggttctttggtgaagcctgcgatttacctgactgca
ctggagcaaccggaaaaatacaatttgggaacaacgctgcatgacacgccactaagtctc
aaaggcagtgaaggcacggtttggacaccgcgtaattacgatcgtaaatatcgtggcgat
gtgccactgtaccttgcgttagcgaagtcgcttaatgtaccaacagtgcgtttgggtatg
gagctaggtattcctgaagtgacgaatacgttagagcgcttaggcgtaagcaaaaatgaa
atccgcccagtgccttccatgttccttggcgcgttttcattgacgccacttgaggtggct
cagatgtaccagactctgacaaactctggcaaacgagcaaggttaacagcacttcgctca
gtcattgatatggaaggaaatgttctataccaatcacttcctcgctcgtctcgtgaggtt
gatgagcaggcggcctggctcaccacttacgcgatgaaacaaggcgttgctcagggaaca
gggcgctatttgcagaatcaattttcttgggctgcattggctggtaaaacaggtactagt
aatgatacccgcgacagttggtttgtgggcgtggacggtcgagaagttaccactatctgg
ctgggacgtgatgataacaaaccaactaatctaaccggcgcgagtggtgctttacgtgtg
tatgccgaatatttgtctcagcgtattcctgaacgtttagcattaccttggccacgagaa
gtaacaactttgggcttcaaacaaaaagccgaaggtgggttggaaatgaactgtcgtagc
gaatataaacttccggtttgggataaaacaggtcaggtaaagcagcagtgtgagaaaaaa
tccaactggattaatgatttatttaattggtag

DBGET integrated database retrieval system