KEGG   Vibrio sp. EJY3: VEJY3_19846Help
Entry
VEJY3_19846       CDS       T01683                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00473  D-Alanine metabolism
vej00550  Peptidoglycan biosynthesis
vej01100  Metabolic pathways
vej01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VEJY3_19846 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VEJY3_19846 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VEJY3_19846 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vej01011]
    VEJY3_19846 (ddl)
Enzymes [BR:vej01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VEJY3_19846 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:vej01011]
 Precursor biosynthesis
  Amino acid ligase
   VEJY3_19846 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEX24388
LinkDB All DBs
Position
2:complement(900253..901242)
Genome map
AA seq 329 aa AA seqDB search
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIENIKVTRVEIKNEGWMTDQGELVYLDL
NTKCLCSNDSNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDALGIPNTPYLFLTKNNEQAHIQAQQAFDKWGKVFVKAARQGSSVGCYSVTEREMLS
DAVNAAFGYSDQVLVEKSVKPRELEVAAYEMNGELYVTKPGEVIAPDGTFYSYDEKYSSA
SHSLTEVEAKNLTPKQIETIKQESETVFKQMNLRHLSRIDFFLTEDGEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLQDCINSAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatattcttctattatgcggtggtggctcttcagagcacgagatatcattg
ctgtctgctaactttgtcgaacaacaactgaatctcattgagaacatcaaggtaacgcgt
gtagagatcaaaaacgaaggttggatgaccgatcaaggcgaattggtttacttggacctc
aataccaaatgcttatgttctaacgactcaaatcagacaattgacttcatcgtaccttgt
attcatggtttccctggtgaaacgggcgatattcaatctctatttgaaatcgctggcatt
ccttatctgggttgcggaccagaagcaagcagtaacagtttcaacaaaatcacatcgaaa
ctttggtacgacgctctaggtataccgaacacaccatacttgttcctgactaaaaataat
gagcaagctcatattcaagctcagcaagcgtttgataagtggggcaaagtattcgttaaa
gcggcaagacaaggatcttcagttggctgttacagcgtaacggaaagagagatgctttct
gacgcggttaatgctgcttttggttactctgatcaagttttagtagaaaagtcagttaag
cctcgagaattagaagttgccgcgtatgaaatgaatggcgaactctatgtgacgaaacct
ggtgaagttatcgcgcctgatggtacattttattcgtacgatgaaaaatacagcagtgcc
agccactcattgacggaagttgaagcaaaaaaccttacaccaaaacagatagagacgatc
aagcaagagtcagagaccgtatttaaacagatgaacctacgtcatttgtctcgtattgat
ttcttccttactgaagatggagagatttacctgaatgaagtgaatacgttcccgggtatg
acaccaatctcgatgttcccaaaaatgcttcaaaacaatggccacaaattccacgagttt
cttcaagactgcatcaatagtgcaaagtaa

DBGET integrated database retrieval system