KEGG   Vibrio sp. EJY3: VEJY3_23641Help
Entry
VEJY3_23641       CDS       T01683                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
vej  Vibrio sp. EJY3
Pathway
vej00550  Peptidoglycan biosynthesis
vej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vej00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VEJY3_23641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vej01002]
    VEJY3_23641
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vej01011]
    VEJY3_23641
Enzymes [BR:vej01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VEJY3_23641
Peptidases and inhibitors [BR:vej01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   VEJY3_23641
Peptidoglycan biosynthesis and degradation proteins [BR:vej01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   VEJY3_23641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AEX25137
LinkDB All DBs
Position
2:complement(1772862..1774016)
Genome map
AA seq 384 aa AA seqDB search
MKVSLAQWIIVTCLVSVPAFAVVTPSPPELQAKGYVLMDFQSGAIIAEQNGRAGLAPASL
TKLMTAYVVGQEIKAGRLNWDDLVTVSENAWSEKFPGSSKMFIKPKDEISVANLMRGVII
QSGNDACVALAEHVAGSEHGFVALMNGWAEKLGLQDTYFVNSHGLDSEGIQTSPLDMATL
MKSIINDVPDVYALYNEKVFKWNDITQYNRNKLLWDKSIKVDGGKTGYTSNAGYSLVSSA
TEGKMRLISVVMGTPSAQARISQSKNLLSYGFRFYDTKKVATQGQVESKVKVWKGKVSEI
EASFPQDAYLTLPRSMTAGLDKSVEMKEPLMAPIEQGEVVGKVVWKNNDETVASYPLVSN
QAVEPASWIGQIWDSIVLWVKSFF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtcactggctcaatggattatcgtgacttgtttagttagcgtgcccgcattt
gcggtggtcacgccaagcccacctgagttacaggcaaaagggtacgtgttaatggacttt
cagtcgggagctattatcgcagaacagaacgggagagccggattagcccctgccagttta
accaaactcatgacggcttatgtcgtgggtcaggaaatcaaagcaggtcgattaaattgg
gatgatttagtgactgtcagcgaaaatgcgtggtcagaaaaattccccggttcctccaaa
atgttcatcaaaccgaaagatgaaatcagcgttgcgaacttgatgcgcggtgtcattatc
caatcgggaaatgacgcatgtgtcgctctggcggaacatgtggcaggcagtgaacatgga
tttgtggcgttgatgaatggctgggccgaaaagctcgggcttcaagatacttactttgtg
aactctcatgggctggatagtgaaggcatccaaacttctcctttggatatggcgacgttg
atgaaatcgatcatcaatgacgtacctgatgtttatgcgctctacaacgaaaaggtgttt
aagtggaacgatattacccaatacaaccgtaataagttgttgtgggataagtctattaaa
gtggacggtggcaaaacaggttacaccagcaatgcgggatatagtctcgtcagttcagcg
actgaaggtaaaatgcgtttgatctctgtcgtgatgggaacacctagcgcgcaagcacgc
atcagtcagtctaaaaacttgctcagctatggtttccgtttttatgacactaagaaggtg
gctacacagggacaggtggaatcaaaggttaaggtctggaaaggcaaggtgagtgaaata
gaagcgagcttcccgcaagatgcctatttgaccctacctcgtagtatgacagctggctta
gataagagtgtcgaaatgaaagaacctttaatggcaccgattgagcaaggggaagtggtt
ggtaaagtcgtgtggaaaaataacgatgaaaccgtcgccagctacccactggtcagcaat
caagcggttgaacccgcgtcatggattggccaaatctgggacagcatcgttttatgggtg
aaatcgtttttttaa

DBGET integrated database retrieval system